KEGG   Bos mutus (wild yak): 102268672
Entry
102268672         CDS       T02919                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04012  ErbB signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04115  p53 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04218  Cellular senescence
bom04630  JAK-STAT signaling pathway
bom04921  Oxytocin signaling pathway
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05216  Thyroid cancer
bom05217  Basal cell carcinoma
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102268672 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102268672 (CDKN1A)
   04066 HIF-1 signaling pathway
    102268672 (CDKN1A)
   04068 FoxO signaling pathway
    102268672 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102268672 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102268672 (CDKN1A)
   04115 p53 signaling pathway
    102268672 (CDKN1A)
   04218 Cellular senescence
    102268672 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102268672 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102268672 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102268672 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102268672 (CDKN1A)
   05206 MicroRNAs in cancer
    102268672 (CDKN1A)
   05205 Proteoglycans in cancer
    102268672 (CDKN1A)
   05203 Viral carcinogenesis
    102268672 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102268672 (CDKN1A)
   05212 Pancreatic cancer
    102268672 (CDKN1A)
   05225 Hepatocellular carcinoma
    102268672 (CDKN1A)
   05226 Gastric cancer
    102268672 (CDKN1A)
   05214 Glioma
    102268672 (CDKN1A)
   05216 Thyroid cancer
    102268672 (CDKN1A)
   05220 Chronic myeloid leukemia
    102268672 (CDKN1A)
   05217 Basal cell carcinoma
    102268672 (CDKN1A)
   05218 Melanoma
    102268672 (CDKN1A)
   05211 Renal cell carcinoma
    102268672 (CDKN1A)
   05219 Bladder cancer
    102268672 (CDKN1A)
   05215 Prostate cancer
    102268672 (CDKN1A)
   05213 Endometrial cancer
    102268672 (CDKN1A)
   05224 Breast cancer
    102268672 (CDKN1A)
   05222 Small cell lung cancer
    102268672 (CDKN1A)
   05223 Non-small cell lung cancer
    102268672 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102268672 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102268672 (CDKN1A)
   05161 Hepatitis B
    102268672 (CDKN1A)
   05160 Hepatitis C
    102268672 (CDKN1A)
   05163 Human cytomegalovirus infection
    102268672 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102268672 (CDKN1A)
   05169 Epstein-Barr virus infection
    102268672 (CDKN1A)
   05165 Human papillomavirus infection
    102268672 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102268672 (CDKN1A)
   01522 Endocrine resistance
    102268672 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102268672
NCBI-ProteinID: XP_005890559
UniProt: A0A6B0R906
LinkDB
Position
Un
AA seq 161 aa
MSELSRDAHQIPRSSKACRCLFGPVDSEQLRQDCDALMASCVQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPVGPRDDLGGGKRPSPSSALLQGTSQEDHLDLSLSCTLVTRS
PERPEGTPGGPGPSQGRKRRQTSMTDFYHSKRRLICSKRKP
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtctgagctgtccagggacgcgcatcaaatcccccgcagcagcaaggcctgccgctgc
ctctttggtccagtggacagcgagcagctgcgccaggactgcgacgccctcatggccagc
tgcgtgcaggaggcccgagagcggtggaacttcgactttgtcaccgagacgccgctggag
ggggacttcgcctgggagcgcgtgaggggcctcggcctgcccaagctctacctgcccgtg
gggccccgagacgacctgggagggggcaagcggccgagcccctcatctgccctgctgcag
ggcacgtctcaggaggaccacttggacctgtcgctgtcctgcaccctcgtgactcgctcc
cccgagcggcccgaggggacccccggtgggcctggcccctcccagggccggaaacggcgg
cagaccagcatgacagatttctaccactccaaacgcaggctgatctgctccaagaggaag
ccctaa

DBGET integrated database retrieval system