KEGG   Bos mutus (wild yak): 102268977
Entry
102268977         CDS       T02919                                 

Gene name
VAC14
Definition
(RefSeq) Vac14, PIKFYVE complex component
  KO
K15305  vacuole morphology and inheritance protein 14
Organism
bom  Bos mutus (wild yak)
Pathway
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102268977 (VAC14)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102268977 (VAC14)
SSDB
Motif
Pfam: Vac14_Fig4_bd Vac14_Fab1_bd HEAT HEAT_EZ TAF6_C
Other DBs
NCBI-GeneID: 102268977
NCBI-ProteinID: XP_005894393
LinkDB
Position
Un
AA seq 781 aa
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQIKHVIQTLSQEF
ALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNI
VKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVGFIPLL
RERIYSNNQYARQFIISWILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVL
GEFLKETKKSPSSVKFAEMANILVIHCQTTDDLIQLTAMCWLREFIQLAGRVMLPYSSGI
LTAVLPCLAYDDRKRNIKEVANVCNQSLMKLVTPEDDEPDEPRPVVQKQAGPSPEDCAAK
QEGAASGGPDGSCDSSFSSGISVFTPASAERAPVTLHLDGIVQVLNCHLSDTAIGMMTRI
AVLKWLYHLYIKTPRKMSRHTDSLFPVLLQTLSDESDEVILKDLEVLAEIASSPAGQTDD
PGPLDGPDLRVSHSELQAPTPGRAGLLHTPGTKGLECSPSTPTMNSYFYXXXXXXXXXSE
RKLLEVRGAFIIRQLCLLLHAESIFHSMADILLREEDLTFASTMVHTLNTILLTSTELFQ
LRNQLKDLKTPESRNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDLIQKFGDLEVTVDF
LTEVDKLVQLIECPIFTYLRLQLLDVKSNPYLIKALYGLLMLLPQSSAFQLLSHRLQCVP
NPELLQTEDGLKAAPKSQKADSPSIDYAELLQHFERVQKKHLEVRHQRSGRGDHLDRRVV
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atgaacccggagaaggatttcgcgccgctcacgcccaacatcgtgcgcgccctcaacgac
aagctctacgaaaagcggaaggtggctgccctggagatcgagaagctggtccgagagttc
gtggcccagaacaacacggtgcagatcaagcatgtgatccagaccttgtctcaggagttt
gccctatctcagcacccccacagccggaaaggtgggctcatcggcctggccgcctgctcc
atcgcactgggcaaggactcggggctctacctaaaggagctgatcgagccggtgctcacc
tgcttcaacgacgccgacagcaggctgcgatactacgcctgtgaggccctctacaacatc
gtcaaggtggcccgaggcgccgtgctgccccacttcaacgtgctcttcgatgggctgagc
aagttggctgctgacccagaccccaatgtgaaaagcggatctgagctcctagaccgcctc
ttaaaggacatcgtgacggagagcaacaagtttgacctggtgggcttcatccccttgttg
cgggagaggatttactccaacaaccagtacgcccggcagttcatcatctcctggatcctg
gtgctggagtccgtgcctgacattaacctcctggactacctgccagagatcctggacggg
ctcttccaaatcctgggcgacaatggcaaagagatccggaaaatgtgtgaggtggtcctt
ggggagttcctgaaggaaacgaagaagagcccctcgagtgtgaagtttgctgagatggcc
aacatcctggtgattcactgccagaccacggacgacctgatccagctgacagccatgtgc
tggctgcgggagttcatccagctggctggccgagtgatgctgccctactcctcagggatc
ctgaccgccgtcctgccctgcctggcctacgacgaccgcaagaggaacatcaaggaggta
gccaatgtctgcaaccagagcctgatgaagctggtcacccccgaggatgacgagcctgac
gagcccaggccagtggtgcagaagcaggcaggccccagccctgaggactgcgcagcaaag
caggagggggcagccagcggagggcctgatggttcttgcgactctagcttcagtagcggc
atcagtgtcttcactccagccagcgcggagagggccccggtcaccctccacctggacggg
atcgtgcaggtgctgaactgccacctcagcgacacggccatcggcatgatgaccaggatc
gccgtcctcaagtggctctaccacctgtacatcaagaccccccgcaagatgtcgcggcac
acggacagcctgttccctgtgctcctgcagacgctgtcggacgagtctgacgaggttatc
ctaaaggatctggaggtgctggcagaaattgcttcttcccctgcaggccagacggatgac
ccaggccccctcgatggccctgacctccgggtcagccactcggagctccaggcgcccacc
cccggcagagccggcctgctgcacacacccggtaccaaaggcttggagtgttctccttcc
accccgaccatgaactcctacttttacnnannnnnnnnnnnnnnnnnnnnnngcagtgag
cggaagctcctggaggtcagaggcgccttcatcatcaggcagctctgcctcctgttgcat
gcggagagcatcttccactcgatggcggacatcttgctccgggaggaggacctcacgttc
gcctcaaccatggtccacaccctcaacaccatcctgctgacctccactgagctcttccag
ctgcgaaaccagctcaaggacctaaagaccccggagagccggaacctgttctgctgcctg
taccgctcctggtgccacaaccccgtcaccacggtgtccctctgcttcctcacccagaac
taccggcacgcctacgacctcatccagaagttcggggacctggaggtcaccgtggatttc
ctcacggaggtggacaagctggtgcagttgatcgagtgccccatcttcacatacctgcgc
ctgcagctgctggacgtgaagagcaacccgtacctgatcaaggccctgtacggcctgctc
atgctgctgccgcagagcagcgctttccagctgctgtcacaccggctgcagtgcgtgccc
aaccctgagctgctgcagaccgaagacggtctgaaggcggcacccaagtcgcagaaagca
gactccccaagcatcgactacgcggagctgctgcagcacttcgagcgggtccagaagaag
cacctggaagtgaggcaccagcggagtgggcgtggggatcacctggaccggagggtggtc
ctctga

DBGET integrated database retrieval system