KEGG   Bos mutus (wild yak): 102269001Help
Entry
102269001         CDS       T02919                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom03410  Base excision repair
Module
bom_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:bom00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    102269001 (LIG3)
Enzymes [BR:bom01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102269001 (LIG3)
DNA repair and recombination proteins [BR:bom03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     102269001 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N zf-PARP DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme Synaptonemal_3 HD_2
Motif
Other DBs
NCBI-GeneID: 102269001
NCBI-ProteinID: XP_005899748
LinkDB All DBs
Position
Un
AA seq 943 aa AA seqDB search
MTLAFKILFPPALRVLRKKELCLFREHRRPDIRHFGRWSETVFCGHHLLQRRKPVPSFQE
SNLKPRATCLVYLPGSHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGK
VVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEENEKEQISQHI
ADLSSKATSTPKKKAVVQAKLTATGQVASPVKGASFVTNSNPRKFSGFSAKPNNSGEAHS
SPTPKTPKTSLSSSKCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIQDFLQKGSAGDG
FHGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNSDDMTRDLEQGDVSETIRVFF
EQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKH
DLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLRNEQEVEKEPGQRRALSVQASLM
TPVQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKKGDHFSYFSRSLKPVLPHKV
AHFKDFIPRAFPGGHSMILDSEVLLIDNRTGKPLPFGTLGVHKKAAFQDANVCLFVFDCI
YFNDVSLMDRPLCERRKLLHDNMVEIPNRIMFSEMKQVTKASDLVDMINRVIQEGLEGLV
LKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDP
SSQKWCTVTKCAGGHDDATLARLQTELDMVKISKDPSKIPNWLKINKIYYPDFIVPDPKK
AAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATTLPQLKELYQLSKERAAF
AITAGDEGSSATGGSSGENEGTSGPAVPHKAPRASPKQPPTSAKKAGGKPGGCTSRGGNL
PAAEPSPVRAGVKRKAPDVTPCQAKRWPASKRRGRRAVPTGRR
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgactttggcttttaagatcctcttcccaccagctctccgtgtactcaggaaaaaagaa
ctgtgcctattccgagaacatcgccggcctgacataagacactttggccggtggtcagag
acagttttttgtggacaccacctcctccagagaagaaagcctgttccgtccttccaggaa
agcaacctaaaaccacgtgccacctgccttgtttacttgccagggtcgcatgtgggactc
tgcagtggcccctgtgagatggcagagcaacgcttctgtgtggactacgccaagcgtggc
acggctggctgcaaaaaatgcaaggaaaagattgtcaagggcgtatgccgaatcggcaaa
gtggtgcccaatcccttttcagagtcggggggcgatatgaaagagtggtaccacattaaa
tgcatgtttgagaaactggagcgggcccgggccaccacaaaaaaaattgaggacctcacc
gagctggaaggctgggaagagctggaagagaacgagaaagagcagataagtcagcacatt
gcagatctatcttccaaggcaacaagcacaccaaagaagaaagctgttgtccaggctaag
ttgacagccactggccaggtagcatctccagtgaaaggtgcctcatttgtcaccaattcc
aatccccggaagttttctggcttttcagccaagcccaacaactctggggaagcccactcc
agccctacccctaagacccctaagacaagtctgtcctcaagcaaatgtgacccgaaacac
aaggattgtctgctgcgtgagtttcggaagttgtgtgccatggtggctgaaaatcctagc
tacaacacgaaaacccagattatccaggacttccttcagaaaggctcagcaggagatggt
ttccacggtgacgtgtacctaacagtgaagctgctgctgccgggtgttattaagagtgtt
tacaacttgaatgataagcagattgtgaagcttttcagccgcatttttaactgcaactca
gatgacatgacacgagacctagagcagggtgacgtgtcagagacaatcagagtcttcttt
gagcagagcaagtctttccctccagctgccaagagcctccttaccatccaggaggtggac
gaattcctcctgcggctctccaagctcaccaaggaggatgagcagcaacaggccctgcag
gatatcgcctccaggtgtacagccaatgaccttaagtgcatcatcaggctgatcaagcat
gacctgaagatgaactcaggggcaaaacacgtgctagatgcgctagaccccaatgcctat
gaagccttcaaagcctcacgcaacctgcaggatgtggtggagcgggtcctccgcaacgag
caggaggtggagaaggagccaggccagagacgagctctgagtgtccaggcctctctgatg
accccagtgcagcccatgctggctgaggcctgcaagtccatcgagtatgccatgaagaag
tgtccaaacggcatgttctctgagatcaagtatgacggggagcgagtccaggtgcataag
aagggggaccacttcagctacttcagccgcagtctcaagcccgtcctgccacacaaggtg
gcccactttaaggacttcatcccccgggctttccctgggggccacagcatgatcttggac
tctgaggtgctcctgatcgacaacaggacaggcaaaccactgccctttgggaccctggga
gtgcacaagaaagctgccttccaggatgccaatgtctgcctgtttgtttttgattgtatc
tacttcaatgatgtcagcttgatggataggcctctgtgtgagcggcggaagcttcttcat
gacaacatggtggagattcccaaccggatcatgttctcagaaatgaaacaagtcacaaaa
gcttccgacttggtggacatgatcaacagggtgatccaagaggggctggaagggctggtg
ctgaaggacgtgaagggtacatatgagcctggaaagcgtcattggctgaaagtgaagaaa
gactatttgaacgagggtgccatggccgacacagctgacctggtggtgcttggggccttc
tacgggcaagggagcaaaggtggcatgatgtccatcttcctcatgggctgctatgacccg
agcagccagaagtggtgcaccgtcaccaagtgtgcaggaggccacgacgacgcgacactc
gcccgcctgcagacggaactggacatggtgaagatcagcaaggatcccagcaagataccc
aactggctgaaaatcaataagatctactaccctgacttcatcgttccagacccaaagaaa
gctgccgtgtgggagatcacaggggctgaattctcgaaatctgaggctcacacagctgat
gggatctccatccgattccctcgctgcacccgaatccgtgatgataaggactggaagtcc
gccacgaccctcccccaactcaaggagctgtaccagctgtccaaggagcgcgcggccttc
gccataacggccggagacgaggggagctccgccacagggggcagcagtggggagaacgag
ggcacctcagggccggctgtgcctcacaaggccccaagagcctcccccaagcagcctccc
accagcgccaagaaggctgggggcaagccgggcggctgcaccagcagaggtggcaacctg
ccagctgcagagccctcccctgtgagagcgggagtgaaacggaaggctcctgatgtgacc
ccgtgccaagccaagaggtggccagccagcaagcggagaggaaggagagctgtgcccaca
ggcaggagatag

DBGET integrated database retrieval system