KEGG   Bos mutus (wild yak): 102269124
Entry
102269124         CDS       T02919                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04020  Calcium signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04114  Oocyte meiosis
bom04140  Autophagy - animal
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04310  Wnt signaling pathway
bom04340  Hedgehog signaling pathway
bom04371  Apelin signaling pathway
bom04530  Tight junction
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04720  Long-term potentiation
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04726  Serotonergic synapse
bom04727  GABAergic synapse
bom04728  Dopaminergic synapse
bom04740  Olfactory transduction
bom04742  Taste transduction
bom04750  Inflammatory mediator regulation of TRP channels
bom04910  Insulin signaling pathway
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04919  Thyroid hormone signaling pathway
bom04921  Oxytocin signaling pathway
bom04922  Glucagon signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04924  Renin secretion
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04961  Endocrine and other factor-regulated calcium reabsorption
bom04962  Vasopressin-regulated water reabsorption
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04976  Bile secretion
bom05012  Parkinson disease
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05032  Morphine addiction
bom05034  Alcoholism
bom05146  Amoebiasis
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102269124 (PRKACB)
   04014 Ras signaling pathway
    102269124 (PRKACB)
   04310 Wnt signaling pathway
    102269124 (PRKACB)
   04340 Hedgehog signaling pathway
    102269124 (PRKACB)
   04371 Apelin signaling pathway
    102269124 (PRKACB)
   04020 Calcium signaling pathway
    102269124 (PRKACB)
   04024 cAMP signaling pathway
    102269124 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102269124 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102269124 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102269124 (PRKACB)
   04540 Gap junction
    102269124 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102269124 (PRKACB)
   04062 Chemokine signaling pathway
    102269124 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    102269124 (PRKACB)
   04910 Insulin signaling pathway
    102269124 (PRKACB)
   04922 Glucagon signaling pathway
    102269124 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    102269124 (PRKACB)
   04912 GnRH signaling pathway
    102269124 (PRKACB)
   04913 Ovarian steroidogenesis
    102269124 (PRKACB)
   04915 Estrogen signaling pathway
    102269124 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    102269124 (PRKACB)
   04921 Oxytocin signaling pathway
    102269124 (PRKACB)
   04926 Relaxin signaling pathway
    102269124 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    102269124 (PRKACB)
   04918 Thyroid hormone synthesis
    102269124 (PRKACB)
   04919 Thyroid hormone signaling pathway
    102269124 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    102269124 (PRKACB)
   04916 Melanogenesis
    102269124 (PRKACB)
   04924 Renin secretion
    102269124 (PRKACB)
   04925 Aldosterone synthesis and secretion
    102269124 (PRKACB)
   04927 Cortisol synthesis and secretion
    102269124 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102269124 (PRKACB)
   04270 Vascular smooth muscle contraction
    102269124 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    102269124 (PRKACB)
   04971 Gastric acid secretion
    102269124 (PRKACB)
   04976 Bile secretion
    102269124 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102269124 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102269124 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102269124 (PRKACB)
   04727 GABAergic synapse
    102269124 (PRKACB)
   04725 Cholinergic synapse
    102269124 (PRKACB)
   04728 Dopaminergic synapse
    102269124 (PRKACB)
   04726 Serotonergic synapse
    102269124 (PRKACB)
   04720 Long-term potentiation
    102269124 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    102269124 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    102269124 (PRKACB)
   04742 Taste transduction
    102269124 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    102269124 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    102269124 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    102269124 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102269124 (PRKACB)
   04714 Thermogenesis
    102269124 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102269124 (PRKACB)
   05205 Proteoglycans in cancer
    102269124 (PRKACB)
   05203 Viral carcinogenesis
    102269124 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102269124 (PRKACB)
   05020 Prion disease
    102269124 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    102269124 (PRKACB)
   05031 Amphetamine addiction
    102269124 (PRKACB)
   05032 Morphine addiction
    102269124 (PRKACB)
   05034 Alcoholism
    102269124 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102269124 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102269124 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102269124 (PRKACB)
   05163 Human cytomegalovirus infection
    102269124 (PRKACB)
   05165 Human papillomavirus infection
    102269124 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102269124 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102269124 (PRKACB)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102269124 (PRKACB)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: AGC group
  PKA family
   102269124 (PRKACB)
Messenger RNA biogenesis [BR:bom03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102269124 (PRKACB)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102269124 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 102269124
NCBI-ProteinID: XP_005887485
UniProt: L8J0N5
LinkDB
Position
Un
AA seq 397 aa
MAAYREVPCNQYTGTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCGKEFCEF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcttacagagaagtaccctgtaaccagtatacaggtactactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacactccaaaggtactgcacatgatcag
aaaacagctctggaaaatgacagccttcatttctctgaacatactgccttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttttaaaaaaatgggaaaatcct
gctccgaataatgctgggctggaggattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacacaaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggaatatgcttttaaggataat
tctaatttatacatggttatggaatatgttcctggtggtgaaatgttttcacatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccaccaaggttatatccaggtcacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatatttggctccagaaatcattctcagcaag
ggctacaataaggcagtggattggtgggcgttaggagtgttaatctatgaaatggcggct
ggctaccccccattctttgcagaccaaccaattcagatttatgaaaaaattgtttctgga
aaggttcgattcccttctcacttcagttcagatctcaaggaccttctaaggaacctgctg
caggtagacttaacaaagcggtttggaaatctaaagaatggtgtgagtgacataaaaact
cacaagtggtttgccacaacagactggattgctatttaccagagaaaggttgaagctcca
ttcataccaaagttcagaggctctggagataccagcaactttgatgactatgaagaagaa
gatatccgtgtctctataacagaaaaatgtgggaaagaattttgtgaattttag

KEGG   Bos mutus (wild yak): 102281757
Entry
102281757         CDS       T02919                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04020  Calcium signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04114  Oocyte meiosis
bom04140  Autophagy - animal
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04310  Wnt signaling pathway
bom04340  Hedgehog signaling pathway
bom04371  Apelin signaling pathway
bom04530  Tight junction
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04720  Long-term potentiation
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04726  Serotonergic synapse
bom04727  GABAergic synapse
bom04728  Dopaminergic synapse
bom04740  Olfactory transduction
bom04742  Taste transduction
bom04750  Inflammatory mediator regulation of TRP channels
bom04910  Insulin signaling pathway
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04919  Thyroid hormone signaling pathway
bom04921  Oxytocin signaling pathway
bom04922  Glucagon signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04924  Renin secretion
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04961  Endocrine and other factor-regulated calcium reabsorption
bom04962  Vasopressin-regulated water reabsorption
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04976  Bile secretion
bom05012  Parkinson disease
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05032  Morphine addiction
bom05034  Alcoholism
bom05146  Amoebiasis
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102281757 (PRKACA)
   04014 Ras signaling pathway
    102281757 (PRKACA)
   04310 Wnt signaling pathway
    102281757 (PRKACA)
   04340 Hedgehog signaling pathway
    102281757 (PRKACA)
   04371 Apelin signaling pathway
    102281757 (PRKACA)
   04020 Calcium signaling pathway
    102281757 (PRKACA)
   04024 cAMP signaling pathway
    102281757 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102281757 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102281757 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102281757 (PRKACA)
   04540 Gap junction
    102281757 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102281757 (PRKACA)
   04062 Chemokine signaling pathway
    102281757 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    102281757 (PRKACA)
   04910 Insulin signaling pathway
    102281757 (PRKACA)
   04922 Glucagon signaling pathway
    102281757 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    102281757 (PRKACA)
   04912 GnRH signaling pathway
    102281757 (PRKACA)
   04913 Ovarian steroidogenesis
    102281757 (PRKACA)
   04915 Estrogen signaling pathway
    102281757 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    102281757 (PRKACA)
   04921 Oxytocin signaling pathway
    102281757 (PRKACA)
   04926 Relaxin signaling pathway
    102281757 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    102281757 (PRKACA)
   04918 Thyroid hormone synthesis
    102281757 (PRKACA)
   04919 Thyroid hormone signaling pathway
    102281757 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    102281757 (PRKACA)
   04916 Melanogenesis
    102281757 (PRKACA)
   04924 Renin secretion
    102281757 (PRKACA)
   04925 Aldosterone synthesis and secretion
    102281757 (PRKACA)
   04927 Cortisol synthesis and secretion
    102281757 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102281757 (PRKACA)
   04270 Vascular smooth muscle contraction
    102281757 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    102281757 (PRKACA)
   04971 Gastric acid secretion
    102281757 (PRKACA)
   04976 Bile secretion
    102281757 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102281757 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102281757 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102281757 (PRKACA)
   04727 GABAergic synapse
    102281757 (PRKACA)
   04725 Cholinergic synapse
    102281757 (PRKACA)
   04728 Dopaminergic synapse
    102281757 (PRKACA)
   04726 Serotonergic synapse
    102281757 (PRKACA)
   04720 Long-term potentiation
    102281757 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    102281757 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    102281757 (PRKACA)
   04742 Taste transduction
    102281757 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    102281757 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    102281757 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    102281757 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102281757 (PRKACA)
   04714 Thermogenesis
    102281757 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102281757 (PRKACA)
   05205 Proteoglycans in cancer
    102281757 (PRKACA)
   05203 Viral carcinogenesis
    102281757 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102281757 (PRKACA)
   05020 Prion disease
    102281757 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    102281757 (PRKACA)
   05031 Amphetamine addiction
    102281757 (PRKACA)
   05032 Morphine addiction
    102281757 (PRKACA)
   05034 Alcoholism
    102281757 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102281757 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102281757 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102281757 (PRKACA)
   05163 Human cytomegalovirus infection
    102281757 (PRKACA)
   05165 Human papillomavirus infection
    102281757 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102281757 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102281757 (PRKACA)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102281757 (PRKACA)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: AGC group
  PKA family
   102281757 (PRKACA)
Messenger RNA biogenesis [BR:bom03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102281757 (PRKACA)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102281757 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 102281757
NCBI-ProteinID: XP_005888070
LinkDB
Position
Un
AA seq 343 aa
MASNPNDVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGN
HYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGE
MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGF
AKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQ
RKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcttccaaccctaacgatgtgaaagagttcttagccaaagccaaagaagattttctt
aaaaaatgggaaaatcctgctcagaacacagcccacttggatcagtttgaacgaatcaag
accctgggtacgggctccttcgggcgggtgatgctggtgaagcacatggagaccgggaac
cactacgccatgaagatcctcgacaaacagaaggtggtgaagctgaaacagattgagcac
accctgaatgagaagcgcatcctgcaggcggtcaactttccgttccttgtcaaactcgag
ttctccttcaaggacaactcaaatttatacatggtcatggagtacgtgcccggtggggag
atgttctcacacctgcgacggatcgggaggttcagtgagccccacgcacgcttctacgcc
gcccagattgtcctgacctttgagtacctgcactcgcttgatctcatctaccgggacctg
aagccagagaacctcctcatcgaccagcagggctacattcaggtgacagactttggtttc
gccaagcgtgtgaaaggccgcacctggaccttgtgtgggacccccgagtacttggccccc
gagatcatcctgagtaaaggctacaacaaagctgtggactggtgggccctgggggtcctc
atctacgaaatggccgcaggctacccgcccttctttgccgaccagcccatccagatctac
gagaagattgtctctgggaaggtgcggtttccgtcccacttcagctctgacttgaaggat
ctgctgcgcaacctcctacaagtggacctcaccaagcgctttgggaacctcaagaatggc
gtcaatgatatcaagaaccacaagtggtttgccacaactgactggattgccatctaccag
aggaaggtggaagctcccttcataccaaagtttaaaggccctggggacacaagtaacttt
gacgactatgaggaggaagagatccgagtctctatcaatgagaagtgtggcaaggagttt
tctgagttctag

DBGET integrated database retrieval system