KEGG   Bos mutus (wild yak): 102269208
Entry
102269208         CDS       T02919                                 

Definition
(RefSeq) placental prolactin-related protein 3
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102269208
   04151 PI3K-Akt signaling pathway
    102269208
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102269208
   04060 Cytokine-cytokine receptor interaction
    102269208
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102269208
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102269208
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102269208
SSDB
Motif
Pfam: Hormone_1 RE_TaqI DUF3135
Other DBs
NCBI-GeneID: 102269208
NCBI-ProteinID: XP_005906860
UniProt: L8HYE4
LinkDB
Position
Un
AA seq 238 aa
MAPAPSFHAHQWTYNPVRGSCLLLLLVMSNLLLCQGKSCLCSCPAVTDIPLESLTVLLLN
ASRLSHNILKHSRTMFHEFDEKYAQNQPYTINATKSCHTNSLHTPQEREKALRMNNEDLS
KWILMLLYSWHRPLYLLVKDLQSMKEVSDTILSSAKENMRKIEELQAFIERQFSQVIYPV
IRTIFKARIYWSGLASLVSNDEDVRHSAFYKLFMCLYRDSRKLDMYTKILACRITNTC
NT seq 717 nt   +upstreamnt  +downstreamnt
atggctccagctcccagcttccatgcacaccagtggacttacaaccctgtccgagggtcc
tgcctgctcctgttgctggtcatgtcaaatctgctactgtgccaaggcaaatcatgcctg
tgctcctgtcctgccgtgactgacatccccctggaatccctaacagtactgttactcaat
gcctccaggctgtcgcacaacatccttaagcattccagaacaatgttccatgagtttgat
gaaaaatatgcccagaaccaaccatacactatcaatgccacgaaaagctgccacaccaat
tccctccatactccccaagaaagagaaaaagccctaaggatgaacaatgaagaccttagt
aagtggatactcatgttactgtactcctggcatagacctctgtatcttctagtcaaggac
ctgcagagtatgaaagaagtctcagatactatcctatcaagtgccaaagagaacatgaga
aaaatagaagaacttcaagcattcatagagaggcaattcagccaggttatttatccagta
atacggacaatattcaaggctcgcatttactggtcaggactcgcatccctggtgtccaac
gatgaagatgtgcgtcattctgcattttacaagctgttcatgtgcctgtatagggattca
cgtaaacttgacatgtacaccaagatcctggcgtgccgaatcaccaacacgtgctaa

KEGG   Bos mutus (wild yak): 102270631
Entry
102270631         CDS       T02919                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102270631 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102270631 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102270631 (CNTF)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102270631 (CNTF)
SSDB
Motif
Pfam: CNTF
Other DBs
NCBI-GeneID: 102270631
NCBI-ProteinID: XP_005907437
UniProt: L8HX40
LinkDB
Position
Un
AA seq 199 aa
MAFAEHSLLPPHLRDLCSRSIWLARKIRSDLTALVDSYMKHQGLNGNMNLDTLEGVPTAS
SSRWSELTEAERLQENLQAYRAFHGMLARLLEDQRAHFTPAEEDFHQAIHAVLLQVAAFA
YQLEELMALLEHRVPPREAGGPPLLPGDAGLFEKKLWGLKVLQELSRWTVRSVHDLRTIS
RQSGVPARGSRCATKDKRM
NT seq 600 nt   +upstreamnt  +downstreamnt
atggctttcgcggagcattcgctgctcccccctcacctccgggacctgtgtagccgctcc
atctggctagcacggaagatccgttcagacctgactgctctggtggactcttacatgaag
catcagggtctgaacgggaacatgaacctggacactctggaaggcgtgccgacggccagc
tccagcaggtggagcgagctgactgaggcggagcggctccaagagaacctccaggcctac
cgcgccttccacgggatgttggcccggctgttggaagaccagcgggcacacttcaccccg
gctgaagaagacttccaccaggcgatacacgctgtcctcctccaggtggcggccttcgcg
taccagctggaggagttgatggcgctgctggagcacagggtgccccccagggaggccggc
gggccgcccctcctccctggggacgctggtctctttgagaagaagctgtggggcctgaag
gtgctgcaggagctttctcggtggacggtgaggtccgtgcatgacctgaggaccatctct
cgacaaagtggggtccccgcacgtgggagccgttgtgccaccaaggacaagagaatgtag

KEGG   Bos mutus (wild yak): 102271434
Entry
102271434         CDS       T02919                                 

Definition
(RefSeq) placental prolactin-related protein 1
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102271434
   04151 PI3K-Akt signaling pathway
    102271434
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102271434
   04060 Cytokine-cytokine receptor interaction
    102271434
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102271434
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102271434
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102271434
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 102271434
NCBI-ProteinID: XP_005897065
UniProt: L8IG46
LinkDB
Position
Un
AA seq 238 aa
MAPAPSFRGHQWTYNPLRGSCLLLLLLMSNLLLCQGNSCPSCSPDVFVSLRKSFKDRFMN
AASLSHDFYNLSTIMFNEFDEKYAQGKLYYINVTKSCHTNSFHAPEEEDKAQQTNIEDLS
KWTLVLLYSWNNPLHHLVTELQHMKELSNAFLSSATRFENMSEKLQAFIERQFSKIIVPV
LNTMIKARSSWTGLPSLMSSDEDRRHSEFYNLFYCLRRDSRKVDMYIKILTCQTHKTC
NT seq 717 nt   +upstreamnt  +downstreamnt
atggctccagctcccagcttccgtggacaccagtggacttataaccctctccgagggtcc
tgcctgctgctgctgctgctcatgtctaatctgctcctgtgccaaggcaactcatgcccg
tcctgcagtcctgacgtgtttgtctccttacggaaatcctttaaagacaggtttatgaat
gccgccagcctctcccatgacttctataacctttccacaataatgttcaatgagtttgat
gaaaaatatgcccagggcaaactatactatatcaatgtcaccaagagctgccacaccaat
tccttccatgctcccgaagaagaagataaagcccagcagacgaacattgaagaccttagt
aagtggacactcgtgttgctgtactcctggaataatcctctgcatcatctagtcacggag
ctgcagcatatgaaagaactgtcaaacgccttcctatcaagcgccacaaggtttgagaac
atgtcagagaaacttcaagcattcatagagcgtcaattcagcaagattattgttccagtc
ttgaatacgatgatcaaggctcgcagtagctggacaggactcccatccctgatgtccagc
gatgaagataggcgtcattcggaattttataacctgttctactgcctgcgcagggattca
cgtaaagttgacatgtacatcaagatcctgacgtgccaaacccacaaaacgtgctaa

KEGG   Bos mutus (wild yak): 102271714
Entry
102271714         CDS       T02919                                 

Definition
(RefSeq) placental prolactin-related protein 3
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102271714
   04151 PI3K-Akt signaling pathway
    102271714
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102271714
   04060 Cytokine-cytokine receptor interaction
    102271714
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102271714
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102271714
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102271714
SSDB
Motif
Pfam: Hormone_1 RVT_N
Other DBs
NCBI-GeneID: 102271714
NCBI-ProteinID: XP_005897066
UniProt: L8IK35
LinkDB
Position
Un
AA seq 236 aa
MAPAPSFCGHQWTYNPVQGSCLLLLLVMSNLLLCQGRTCPFCCSDVFDIPLESLRNLFLN
ATMLSRDIAIHSSIMFTDFDEKYAQGKQYDINDESCHTDPLPTPEEREQALKINNEDLSK
WIIMLLYSWKRPLYHLVTELQNMKEVSDTILSSARQNLKKVQELQEFIERQFSQIIFPVR
RLTEGEIVWSELPSLVSSDEDIRHSAFYNLFKCLQRDSHKVDMYTKIMLCRINNTC
NT seq 711 nt   +upstreamnt  +downstreamnt
atggctccagctcccagcttctgtggacaccagtggacttacaaccctgtccaagggtcc
tgcctgcttctgctgctggtcatgtcaaatctgctcctgtgccaaggcagaacatgccca
ttctgctgttctgacgtgtttgacatccccttggaatcccttagaaacctgtttctcaat
gctaccatgttatcccgtgacattgccatccattccagcataatgttcactgattttgat
gaaaaatatgcccagggcaaacagtacgatatcaatgacgagagctgccataccgatccc
ctccctactcccgaagaaagagaacaagccctaaagataaacaatgaagacctgagtaag
tggataatcatgttactgtactcctggaaaagacctctgtatcatctagtcacagagctg
cagaatatgaaagaagtctcagatactatcctatcaagtgccagacaaaatttgaaaaaa
gtacaagaacttcaagaattcatagagaggcaattcagccagattatttttccagtaagg
cggctgaccgagggtgaaatagtctggtcagaacttccatccctggtgtccagcgatgaa
gatattcgtcattctgcattttataacctgttcaagtgcctgcagagggattcacataaa
gttgacatgtacaccaagatcatgttgtgccgaatcaacaacacgtgctaa

KEGG   Bos mutus (wild yak): 102271788
Entry
102271788         CDS       T02919                                 

Definition
(RefSeq) somatotropin
  KO
K05438  growth hormone
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102271788
   04151 PI3K-Akt signaling pathway
    102271788
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102271788
   04060 Cytokine-cytokine receptor interaction
    102271788
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102271788
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102271788
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102271788
SSDB
Motif
Pfam: Hormone_1 XTBD
Other DBs
NCBI-GeneID: 102271788
NCBI-ProteinID: XP_005911160
LinkDB
Position
Un
AA seq 217 aa
MMAAGPRTSLLLAFALLCLPWTQVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFER
TYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLS
RVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDA
LLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
NT seq 654 nt   +upstreamnt  +downstreamnt
atgatggctgcaggcccccggacctccctgctcctggctttcgccctgctctgcctgccc
tggactcaggtggtgggtgccttcccagccatgtccttgtccggcctgtttgccaacgct
gtgctccgggctcagcacctgcatcagctggctgctgacaccttcaaagagtttgagcgc
acctacatcccggagggacagagatactccatccagaacacccaggttgccttctgcttc
tctgaaaccatcccggcccccacgggcaagaatgaggcccagcagaaatcagacttggag
ctgcttcgcatctcactgctcctcatccagtcgtggcttgggcccctgcagttcctcagc
agagtcttcaccaacagcttggtgtttggcacctcggaccgtgtctatgagaagctgaag
gacctggaggaaggcatcctggccctgatgcgggagctggaagatggcaccccccgggct
gggcagatcctcaagcagacctatgacaaatttgacacaaacatgcgcagtgacgacgcg
ctgctcaagaactacggtctgctctcctgcttccggaaggacctgcataagacggagacg
tacctgcgggtcatgaagtgccgccgcttcggggaggccagctgtgccttctag

KEGG   Bos mutus (wild yak): 102272188
Entry
102272188         CDS       T02919                                 

Gene name
CSF3
Definition
(RefSeq) colony stimulating factor 3
  KO
K05423  granulocyte colony-stimulating factor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04657  IL-17 signaling pathway
bom05144  Malaria
bom05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272188 (CSF3)
   04151 PI3K-Akt signaling pathway
    102272188 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102272188 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102272188 (CSF3)
   04657 IL-17 signaling pathway
    102272188 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102272188 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    102272188 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272188 (CSF3)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102272188 (CSF3)
SSDB
Motif
Pfam: GCSF IL11
Other DBs
NCBI-GeneID: 102272188
NCBI-ProteinID: XP_005898085
UniProt: A0A6B0RST1
LinkDB
Position
Un
AA seq 195 aa
MKLMVLQLLLWHSALWTVHEATPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAH
KLCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGLFLYQGLLQALAGISPEL
APTLDTLQLDVTDFATNIWLQMEDLGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHR
FLELAYRGLRYLAEP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctgatggtcctgcagctgctcctctggcacagtgcgctctggacggtgcacgaa
gccaccccccttggccctgcccgatccctgccccagagcttcctgctcaagtgcttagag
caagtgaggaaaatccaggctgatggcgccgagctgcaggagaggctgtgtgccgcccac
aagctgtgccacccggaggagctgatgctgctcaggcactctctgggcatcccccaggct
cccctaagcagctgctccagccagtccctgcagctgacgagctgcctgaaccaactacac
ggcggcctctttctctaccagggcctcctgcaggccctggcgggcatctccccagagctg
gcccccaccttggacacactgcagctggacgtcactgactttgccacgaacatctggctg
cagatggaggacctgggggcggcccccgctgtgcagcccacccagggcgccatgccgacc
ttcacttcagccttccaacgcagagcaggaggggtcctggttgcttcccagctgcatcgt
ttcctggagctggcataccgtggcctgcgctaccttgctgagccctga

KEGG   Bos mutus (wild yak): 102272287
Entry
102272287         CDS       T02919                                 

Definition
(RefSeq) placental prolactin-related protein 4
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272287
   04151 PI3K-Akt signaling pathway
    102272287
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102272287
   04060 Cytokine-cytokine receptor interaction
    102272287
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102272287
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272287
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102272287
SSDB
Motif
Pfam: Hormone_1 Brix
Other DBs
NCBI-GeneID: 102272287
NCBI-ProteinID: XP_005897067
UniProt: L8IH40
LinkDB
Position
Un
AA seq 240 aa
MAPAPSFRGHQWTYNLVRARSCLLHLLVISNLLLCQGKLCPICCPDVFDFPLDSLTDLLI
DAARLSHDFHNHSTIMFNEFDEQYAQGKEYFINVSDKCHTNSLHLPEDMQHIRRMNSKGL
IMWILMLLYSWQKPLYQLVTDLRSMKEVSNTILSSARENVKKLKELQALIERPFSQVIFT
ARRKMYIARIYWFGLRSLLSSNEDRRHSAFYSLFFCLRRDTRKLDIYTKFVACRLIYKRC
NT seq 723 nt   +upstreamnt  +downstreamnt
atggctccagctcccagcttccgtggacaccagtggacttacaacctggtccgagcaagg
tcctgcctgctccatttgctggtcatatctaatctgctcctgtgccaaggcaaattatgc
ccaatctgctgtcctgacgtgtttgacttccccctggattcccttacagacctgcttatc
gatgctgccaggctgtcccatgacttccataaccattccaccataatgttcaatgagttt
gatgaacagtatgcccagggcaaagagtactttatcaatgtctccgacaagtgccacacc
aattccctccatctccctgaagatatgcagcacatccgacggatgaacagtaaaggcctt
attatgtggatactcatgttactatactcctggcaaaaacctctgtatcagctagtcacg
gacctgcggagtatgaaagaagtctcaaatactatcctatccagcgctagagaaaatgtg
aaaaaactaaaagaacttcaagcactcatagagaggccgttcagccaggttatttttaca
gccaggaggaagatgtacatcgctcgcatttactggtttggactccgatccctactgtcg
agcaatgaagataggcgtcattctgcattttatagcctgttcttctgcctgcgcagagat
actcgtaaacttgacatttacaccaagttcgtggcatgccgactgatctataagaggtgt
taa

KEGG   Bos mutus (wild yak): 102272572
Entry
102272572         CDS       T02919                                 

Definition
(RefSeq) chorionic somatomammotropin hormone 2
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272572
   04151 PI3K-Akt signaling pathway
    102272572
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102272572
   04060 Cytokine-cytokine receptor interaction
    102272572
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102272572
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272572
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102272572
SSDB
Motif
Pfam: Hormone_1 TAFH Sad1_UNC DcpS_C Dehydratase_LU Het-C
Other DBs
NCBI-GeneID: 102272572
NCBI-ProteinID: XP_005897068
LinkDB
Position
Un
AA seq 123 aa
NEDLSKWTLVLLYSWNNPLYYLVLELRNMKNLSEAVISSAMEIENMSEKLQAFIESQFRK
IIVPVLKMIHEVSNTWSRFSSMTFSDEDRSISEYYNLFYCLRRDSRKVDMYIKILTCRTR
KTC
NT seq 372 nt   +upstreamnt  +downstreamnt
aatgaagaccttagtaagtggacacttgtgttactgtactcctggaataatcctctgtat
tatctagtcctggagcttcggaatatgaaaaatctgtcagaggcagtcatatcaagtgcc
atggagattgagaacatgtcagagaaacttcaagcattcattgagagtcaattcaggaag
attattgttccagtcttgaagatgatacacgaggttagcaatacctggtcaagattctca
tccatgacgttcagcgatgaagataggagtatttctgaatattataacctgttctactgc
ctgcgcagggattcacgtaaagttgacatgtacatcaagatcctgacgtgccgaacccgc
aaaacatgctaa

KEGG   Bos mutus (wild yak): 102272860
Entry
102272860         CDS       T02919                                 

Definition
(RefSeq) placental prolactin-related protein 1
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272860
   04151 PI3K-Akt signaling pathway
    102272860
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102272860
   04060 Cytokine-cytokine receptor interaction
    102272860
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102272860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272860
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102272860
SSDB
Motif
Pfam: Hormone_1 PIG-U
Other DBs
NCBI-GeneID: 102272860
NCBI-ProteinID: XP_014334080
UniProt: L8IIY0
LinkDB
Position
Un
AA seq 238 aa
MAPAPSFRGHQWTYNSVRGSCLLLLLLRSNLRLCQGNSCPSCSPDVFVSLRKSLTDLFIN
AASLSHDFHNLSTIMFHKFDEKYAQGKLYYINVTKSCHTNSFHAPEEEDKAQQTNNEDLS
KWTLMLLYSWNNPLYHLVTELQSMKEVSEAFLSSAIKIENMSDKLQSFIESQFSKIIVPV
LKMIHEAPSSWSGLPSLTSSDEDRRLSEFYNLFYCLSRDSRKVDTYIKILTCRTRKTC
NT seq 717 nt   +upstreamnt  +downstreamnt
atggctccagctcccagcttccgtggacaccagtggacttacaactctgtccgaggttcc
tgcctgctgctgctgctgctcaggtctaatctgcgcctatgccaaggcaactcatgcccg
tcctgcagtcctgacgtgtttgtctccttacggaaatcccttacagacttgtttatcaat
gccgccagcctctcccatgacttccataacctttccacaataatgttccataagtttgat
gaaaaatatgcccagggcaaactatactatatcaatgtcaccaagagctgccacaccaat
tccttccatgctcccgaagaagaagataaagcccagcagacgaacaatgaagaccttagt
aagtggacactcatgttactgtactcctggaataatcctctgtaccatctagtcacggag
ctgcagagtatgaaagaagtgtcagaggctttcctatcaagcgccataaagattgagaac
atgtcagacaaacttcagtcattcatagagagtcaattcagcaagattattgttccagtc
ttgaagatgatccacgaggctcccagtagctggtcaggactcccatccctgacgtccagc
gatgaagacaggcgtctttctgaattttataacctgttctactgcctgagcagggattca
cgtaaagttgacacgtacatcaagatcctgacgtgccgaacccgcaaaacgtgctaa

KEGG   Bos mutus (wild yak): 102273139
Entry
102273139         CDS       T02919                                 

Definition
(RefSeq) placental prolactin-related protein 4
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102273139
   04151 PI3K-Akt signaling pathway
    102273139
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102273139
   04060 Cytokine-cytokine receptor interaction
    102273139
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102273139
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102273139
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102273139
SSDB
Motif
Pfam: Hormone_1 UPF0128
Other DBs
NCBI-GeneID: 102273139
NCBI-ProteinID: XP_005897070
LinkDB
Position
Un
AA seq 429 aa
MAPNEETDLSKTHRSTEQNSEAGKKCTPVYCRLAYEKGAKTIQYQPEERDSSTPHAVEPY
FYRLMAFLKKHSMQQIFSILSHQADSPRSTGVLTLGSFHNPHGSSSQLPWTPVDLQPCLR
YERMQHGWSVVLTPFRLSQISEFTPQLLQLPPPSQWMAMDAGISPLRFSSLSPRLTPHGQ
QASSPWDHSPFARAPVPSFCGLQWTYNPVRGSCLLLLLVMSNLLLCQGNSCPSCCPDVSD
IPLDLLRELFLNATLLSQSILKHSRIMLNEFDEKYAQGKLYYLTATKSCHTNSLHTTEDM
DKAEKIDNEDLSKWILMLLYSWHRPLNHLVTDMRGMIEVSDTILSNAKENVKKVEELQAF
IERQFCQIIIPVMRKMLENNIYWSGLPSLLSSNEDVRHSAFYSLFHCLHRDTLEIDIYTK
ILARRMINT
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggcacccaacgaggagactgacttgtctaagacacatagatcaacagagcagaacagc
gaagccggaaagaaatgcacacccgtatattgtcggttagcttatgaaaaaggagctaag
actatccagtaccagcctgaagaaagagatagctctactccacatgcagtagaaccctac
ttttatcgcctcatggctttccttaagaagcattccatgcagcagattttctctatccta
tctcatcaggctgactccccacggtcaacaggagtcctcaccctggggtcattccacaat
ccccatggctccagctcccagcttccatggacaccagtggacttacaaccctgtctgagg
tatgaaaggatgcagcatggctggtctgtggttctcactccgttcagactgtcacagatt
agcgagttcactccccaactgcttcaactgcctcccccgtcccagtggatggccatggat
gcggggatctctcccctgcgcttcagctccctctcccccaggctgactccccatggtcag
caggcatcctcaccctgggatcattccccattcgccagggctccagttcccagcttctgt
ggactccagtggacttacaaccctgtccgagggtcctgcctgctgctgctgctggtcatg
tcaaatctgctcctgtgccaaggcaactcatgcccgtcctgctgtcctgacgtgtctgac
atccccctggatttacttagagaactgtttctcaatgccaccttgctgtcccaaagcatc
cttaagcattccagaataatgttgaatgagtttgatgaaaagtatgcccagggcaaactg
tactatctcactgccaccaagagctgccataccaattccctccatactaccgaagacatg
gacaaagccgaaaagatagacaatgaagaccttagtaagtggatactcatgttactgtac
tcctggcatagacctctgaatcatctagtcactgacatgcggggtatgatcgaagtctca
gacactatcctatcaaatgccaaagagaacgtgaaaaaagtagaagaacttcaagcattc
atagagaggcaattctgccagattattattccagtaatgcggaagatgttggagaataat
atttactggtcgggactcccatccctgttgtccagcaatgaagatgtgcgtcattctgca
ttttatagcctgttccactgcctgcacagggacacacttgaaattgacatttacaccaag
atcctggcacgccgaatgatcaacacctag

KEGG   Bos mutus (wild yak): 102274562
Entry
102274562         CDS       T02919                                 

Definition
(RefSeq) chorionic somatomammotropin hormone 1
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102274562
   04151 PI3K-Akt signaling pathway
    102274562
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102274562
   04060 Cytokine-cytokine receptor interaction
    102274562
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102274562
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102274562
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102274562
SSDB
Motif
Pfam: Hormone_1 TRH
Other DBs
NCBI-GeneID: 102274562
NCBI-ProteinID: XP_005894332
LinkDB
Position
Un
AA seq 275 aa
MVARFSSLGIPHHRFPPFSPVGPSPHQQQSSSWDFSPILMAPASSHRGHQWICDLVRGSC
LLLLLVVSNLLLCQGVEDYAPYCKNQPGNCRIPLQSLFERATLVASNNYRLAREMFNEFN
KQYGEGKNFTSKVINSCHTEFMTTPNNKEAAANTEDEALFRLVISLLHSWDEPLHQAVTE
LLHRNGASPDILARAKEIEDKAKVLLEGVEMIQKRVHPGEKKNEPYPVWSEKSSLTADDE
DVRQTAFYRMFHCLHRDSSKISTYINLLKCRFTPC
NT seq 828 nt   +upstreamnt  +downstreamnt
atggttgccaggttttcctccttaggcattccccaccacagatttcctccattcagtcct
gttgggccatctccccatcagcagcagtcctcatcctgggatttctctccaatcctcatg
gctccagcatctagccatcgtgggcaccagtggatttgtgaccttgttcgagggtcctgc
ctgctcctgctgctggtggtgtcaaatctactcttgtgccagggtgtggaggattatgca
ccatactgtaaaaaccaacctggcaactgccggattccccttcaaagcctgtttgagaga
gcaacattggtggctagcaacaactataggctcgccagggaaatgttcaatgaatttaat
aaacagtatggcgagggcaaaaacttcacttccaaggtcatcaacagctgccacaccgaa
ttcatgactacccctaataacaaagaagcagctgcaaatacagaggacgaagccctgttt
aggttggttatcagtttgctccactcgtgggatgaacctctgcatcaggcagtcacagag
ttgttgcacaggaatggagcctcacctgatatcttggcaagggctaaagagattgaggac
aaggccaaagtacttctagaaggtgtggaaatgatacaaaaaagggttcatcctggagag
aagaagaacgagccctatccagtgtggtcagaaaagtcctccctgacagcagacgatgag
gatgtgcgccaaactgccttttatagaatgttccactgcctacacagggattcgagtaaa
attagcacctacatcaatttgcttaagtgccgattcaccccatgctaa

KEGG   Bos mutus (wild yak): 102275031
Entry
102275031         CDS       T02919                                 

Gene name
PRL
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275031 (PRL)
   04151 PI3K-Akt signaling pathway
    102275031 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102275031 (PRL)
   04060 Cytokine-cytokine receptor interaction
    102275031 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102275031 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102275031 (PRL)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102275031 (PRL)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 102275031
NCBI-ProteinID: XP_005894334
UniProt: A0A6B0RX14
LinkDB
Position
Un
AA seq 229 aa
MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIH
DLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRS
WNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVW
SGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
NT seq 690 nt   +upstreamnt  +downstreamnt
atggacagcaaaggttcgtcgcagaaagggtcccgcctgctcctgctgctggtggtgtca
aatctactcttgtgccagggtgtggtctccacccccgtctgtcccaatgggcctggcaac
tgccaggtatcccttcgagacctgtttgaccgggcagtcatggtgtcccactacatccat
gacctctcctcggaaatgttcaacgaatttgataaacggtatgcccagggcaaagggttc
attaccatggccctcaacagctgccatacctcctcccttcctacccctgaagataaagaa
caagcccaacagacccaccatgaagtccttatgagcttgattcttgggttgctgcgctcc
tggaatgaccctctgtatcacctagtcaccgaggtgcggggtatgaaaggagccccagat
gctatcctatcgagggccatagagattgaggaagaaaacaaacgacttctggaaggcatg
gagatgatatttggccaggttattcctggagccaaagagactgagccctaccctgtgtgg
tcaggactcccgtccctgcaaactaaggatgaagatgcacgttattctgctttttataac
ctgctccactgcctgcgcagggattcaagcaagattgacacttaccttaagctcctgaat
tgcagaatcatctacaacaacaactgctaa

KEGG   Bos mutus (wild yak): 102275287
Entry
102275287         CDS       T02919                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275287 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275287 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102275287 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102275287 (THPO)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102275287 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102275287
NCBI-ProteinID: XP_005909565
LinkDB
Position
Un
AA seq 353 aa
MELTELLLVVILLLTARITLSSPAPPACDPRLLNKLLRDSHVLHSRLSQCPDVNPLSTPV
LLPAVDFSLGEWKTQTEQTKAQDVLGTTTLLLEAVMTARGQLGPTCLSSLLVQLSGQVRL
LLGALQGLLGTQLPPQGRTTAHKDPSAIFLSFQQLLRGKVRFLLLVVGPSLCAKRAPPTT
AVPGSISPLLTLNKLPNRTSGLLETNSSVSARTTGFGLPNRLQGFRAKIPGLMNQTSRSL
GQIPGHLNGTQGPLSGVHGLFPGPSPRALGAPDIPLGTSDMGSLPPYLQPGDSPSPAHPP
PGQYTLFSPSPTSPIPTVHLQPLLPDPSAITPNSSSSLLVAAHSHFRNLSQEE
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagctgactgaattgctcctcgtggtcatccttctcctaactgcaagaataactctg
tccagcccggctcctcctgcctgtgacccccgactcctaaataaactgcttcgtgactcc
catgtccttcacagcagactgagccagtgtccagacgtgaaccctttgtccacacctgtc
cttctgcctgctgtggacttcagcttgggagaatggaaaacccagacggagcagaccaaa
gcacaggacgtcctgggaaccacgacccttctgctggaggcagtgatgacagcgcgggga
cagctgggccccacttgcctctcatccctcctggtgcagctttctgggcaggtccgcctc
cttcttggggccctgcagggcctcctaggaacccagcttcctccacagggcaggaccaca
gctcacaaggatcccagtgccatcttcctgagcttccaacagctgctccgaggaaaggtg
cgcttcctgctgcttgtagtggggcccagcctctgtgccaagcgggccccacccaccaca
gctgtcccgggcagcatctctccattgctcacactgaacaagctcccaaacaggacttct
ggattgttggagaccaactccagtgtctcagccagaactactggctttggacttccgaac
aggctgcaaggattcagagccaagattcctggtctgatgaaccaaacctccaggtcctta
ggccaaatccctggacacctgaatgggacacaaggacccttaagtggagttcatggactc
tttcctgggccctcacccagggccctaggagccccggatattcctctgggaacttcagac
atgggctccctgccaccctacctccagcctggagattctccttccccagcccatcctccc
cctggacaatacacactcttctctccttcgccaacctcacccatccccacggtccacctc
caacccctgcttcctgacccctcagccatcacacccaactcttccagttctcttctagtt
gcagcccactctcacttccggaatctgtctcaggaagagtaa

KEGG   Bos mutus (wild yak): 102276676
Entry
102276676         CDS       T02919                                 

Definition
(RefSeq) chorionic somatomammotropin hormone 2-like
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102276676
   04151 PI3K-Akt signaling pathway
    102276676
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102276676
   04060 Cytokine-cytokine receptor interaction
    102276676
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102276676
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102276676
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102276676
SSDB
Motif
Pfam: Hormone_1 TAFH zf-HYPF
Other DBs
NCBI-GeneID: 102276676
NCBI-ProteinID: XP_014336786
LinkDB
Position
Un
AA seq 240 aa
MAPAPNFHGHQWTYNPVRGSCLLLLLVVSNLLLCQGISCPSCGPDMFVSLQKSLIDVFIN
IDAAWLSHEFHNLSAIMFSEFKEKYAQGKLYHINATNSCHTNSFHAPEERDKAHQMNNED
LSKWTLVLLYSWNNPLYHLVPRLRNMKNLSEAVVSSAMEIENMSDKLQAFIESQFRKVIV
SVLKTIHEARSSWSGLPSLTSSDEDRRLSEFYNLFHCLCRDSGKVDTYIKILTCRIRKKC
NT seq 723 nt   +upstreamnt  +downstreamnt
atggctccagctcccaacttccatggacaccagtggacttacaaccctgtccgagggtcc
tgcctgctgctgctgctggtcgtgtctaatctgctcctgtgccaaggcatctcctgcccg
tcctgcggtcctgacatgtttgtctccttacagaaatcccttattgacgtgtttatcaat
attgatgctgcctggctctcccacgaattccataacctttctgcaataatgttcagtgag
tttaaagaaaaatatgcccagggcaaactgtaccatatcaatgccaccaacagctgccac
accaattccttccatgctcccgaagaaagagataaagcccaccagatgaataatgaagac
cttagtaagtggacactcgtgttactgtattcctggaataatcctctgtatcatctagtc
ccgaggcttcggaatatgaaaaatctgtcagaggctgtcgtatcaagtgccatggagatt
gagaacatgtcagacaaacttcaggcattcatagagagtcaattcaggaaggttattgtt
tcagtcttgaagacgatacacgaggctcgcagtagctggtcaggactcccatccctgacg
tccagcgatgaagataggcgtctttctgaattttataacctgttccactgcctgtgcagg
gattcagggaaagttgacacgtacatcaagatcctgacgtgccgaatccgcaaaaagtgc
taa

KEGG   Bos mutus (wild yak): 102276736
Entry
102276736         CDS       T02919                                 

Gene name
LEP
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04152  AMPK signaling pathway
bom04630  JAK-STAT signaling pathway
bom04920  Adipocytokine signaling pathway
bom04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102276736 (LEP)
   04152 AMPK signaling pathway
    102276736 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102276736 (LEP)
   04060 Cytokine-cytokine receptor interaction
    102276736 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102276736 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102276736 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102276736 (LEP)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102276736 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 102276736
NCBI-ProteinID: XP_005893728
UniProt: L8INC6
LinkDB
Position
Un
AA seq 167 aa
MRCGSLYRFLWLWPYLSYVEAVPISKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGL
DFIPGLHPLLSLSKMDQTLAIYQQILTSLPSRNVVQISNDLENLRDLLHLLAASKSCPLP
QVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcgctgtggatccctgtatcgattcctgtggctttggccctatctgtcctacgtggag
gctgtgcccatcagcaaggtccaggatgacaccaaaaccctcatcaagacgattgtcacc
aggatcaatgacatctcacacacgcagtccgtctcctccaaacagagggtcactggtttg
gacttcatccctgggctccaccctctcctgagtttgtccaagatggaccagacattggcg
atctaccaacagatcctcaccagtctgccttccagaaatgtggtccaaatatccaatgac
ctggagaacctccgggaccttctccacctgctggccgcctccaagagctgccccttgccg
caggtcagggccctggagagcttggagagcttgggcgtcgtcctggaagcttccctctac
tccactgaggtggtggccctgagccggctgcaggggtcactacaggacatgttgcggcag
ctggacctcagtcctgggtgctga

KEGG   Bos mutus (wild yak): 102276948
Entry
102276948         CDS       T02919                                 

Definition
(RefSeq) chorionic somatomammotropin hormone 2
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102276948
   04151 PI3K-Akt signaling pathway
    102276948
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102276948
   04060 Cytokine-cytokine receptor interaction
    102276948
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102276948
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102276948
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102276948
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 102276948
NCBI-ProteinID: XP_005905361
LinkDB
Position
Un
AA seq 278 aa
MASWLSLRSIQCSTCPPSHPIRLTPHGQQESSPWDHSTVPMAPAPSFRGLQWTYNPVRGS
CLLLLLVVSNLLLCQGKSCPSCSPDVFVSLQKSLTDVFVYALSLSHDIHNLSTIMFNEFD
EKYAQGKLYHINATKSCHTNSFHTPEEGDKAQQTNNEDLIKWTLVLLYCWNNPLYYLVPE
IQSMKNLSEAVVSSAEEIENMSEKLESLIETHFGKIIFPVLKTIHEARIPWSRYSSMKFS
NEDRRISEYYNLFYCLRRDSHKVDMYINILECRTRKTC
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcctcatggctttccttaagaagcattcaatgcagcacatgtcctccatcccatccc
atcaggctgactccccacggtcaacaggagtcctcaccctgggatcattccacagtcccc
atggctccagctcccagtttccgtggactccagtggacttacaaccctgtccgagggtcc
tgcctgctgctgctgctggtcgtgtctaatctgctcctgtgccaaggcaaatcatgccca
tcctgcagtcctgacgtgtttgtctccttacagaaatcccttacagacgtgtttgtctat
gccctcagcctctcccacgacatccataacctttccacaataatgttcaatgagtttgat
gaaaaatatgcccagggcaaactgtaccatatcaatgccaccaagagctgccacaccaat
tccttccatactcccgaagaaggagataaagcccagcagacgaacaatgaagaccttatt
aagtggacactcgtgttactgtactgctggaataatcctctgtattatctagttccggag
attcagagtatgaaaaatctgtcagaggctgtcgtatcaagtgccgaagagattgagaac
atgtcagagaaacttgaatcattaatagagactcatttcgggaagattatttttccagtc
ttgaagacgatacacgaggctcgcattccctggtcaagatactcatccatgaagttcagc
aatgaagataggcgtatttctgaatattataacctgttctactgcctgcgcagggattca
cataaagttgacatgtacatcaacatcctggagtgccgaacccgcaaaacatgctaa

KEGG   Bos mutus (wild yak): 102279821
Entry
102279821         CDS       T02919                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04066  HIF-1 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102279821 (EPO)
   04066 HIF-1 signaling pathway
    102279821 (EPO)
   04151 PI3K-Akt signaling pathway
    102279821 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102279821 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102279821 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102279821 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102279821 (EPO)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102279821 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102279821
NCBI-ProteinID: XP_005910850
LinkDB
Position
Un
AA seq 192 aa
MGARDCTPLLMLSFLLFPLGFPVLGAPARLICDSRVLERYILEAREAENATMGCAEGCSF
NENITVPDTKVNFYAWKRMEVQQQALEVWQGLALLSEAILRGQALLANASQPCEALRLHV
DKAVSGLRSLTSLLRALGAQKEAISLPDATPSAAPLRAFTVDALSKLFRIYSNFLRGKLT
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggcgcgcgactgtactccgctgctgatgctgtcctttctgctgtttcctttgggc
ttcccagtcctgggcgcccccgcacgcctcatctgtgacagccgagtcctggagaggtac
atcctggaggccagggaggccgaaaatgccacgatgggctgtgcagaaggctgcagcttc
aatgagaatatcactgtgccagacaccaaggttaacttctatgcctggaagaggatggag
gtccagcagcaggctctggaagtctggcagggcctggccctgctctcagaagctatcctg
cggggccaggccctattggccaacgcgtcccagccatgcgaggccctgcggctgcacgtg
gacaaagctgtcagcggcctccgcagtctcacctccctgcttcgggcgctgggagcccag
aaagaagccatctcccttccagatgcaaccccctccgcagccccactccgagcattcact
gttgatgctttgtccaagcttttccgaatctactccaatttcctgcggggaaagctgact
ctgtacacaggggaggcctgcaggagaggggacaggtga

KEGG   Bos mutus (wild yak): 106701660
Entry
106701660         CDS       T02919                                 

Definition
(RefSeq) placental prolactin-related protein 1-like
  KO
K05439  prolactin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106701660
   04151 PI3K-Akt signaling pathway
    106701660
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106701660
   04060 Cytokine-cytokine receptor interaction
    106701660
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    106701660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    106701660
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   106701660
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 106701660
NCBI-ProteinID: XP_014339003
LinkDB
Position
Un
AA seq 139 aa
YQHGERDSSTPQAVEPYFYGLMAFLKKHSTQQISSIPSHPIWLTPHGQQESSPWDHSAIP
MAPAPSFRGHQWTYNPVRGSCLLLLMVMSNLLLCQGNSCPSCCPDVFDIPLESLTHLFLN
ASRLSHDIVNHTTIMFHEF
NT seq 418 nt   +upstreamnt  +downstreamnt
gtaccagcatggagaaagagatagctctactccacaggcagttgaaccctacttttatgg
cctcatggctttccttaagaagcattccacgcaacagatttcttccatcccatctcatcc
catctggctgactccccacggtcaacaggagtcctcaccctgggatcattccgcaatccc
catggctccagctcccagcttccgtggacaccagtggacttacaaccctgtccgaggttc
ctgcctgctcctgctgatggtcatgtcaaatctgctcctgtgccaaggcaactcatgccc
gtcctgctgtcctgacgtgtttgacatccccctggaatcccttacacacctgtttctcaa
tgcctccaggctgtcacatgatatcgttaaccataccaccataatgttccatgagttt

DBGET integrated database retrieval system