KEGG   Bos mutus (wild yak): 102269608
Entry
102269608         CDS       T02919                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
bom  Bos mutus (wild yak)
Pathway
bom03460  Fanconi anemia pathway
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05216  Thyroid cancer
bom05217  Basal cell carcinoma
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    102269608 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102269608 (POLK)
   05202 Transcriptional misregulation in cancer
    102269608 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102269608 (POLK)
   05212 Pancreatic cancer
    102269608 (POLK)
   05225 Hepatocellular carcinoma
    102269608 (POLK)
   05226 Gastric cancer
    102269608 (POLK)
   05214 Glioma
    102269608 (POLK)
   05216 Thyroid cancer
    102269608 (POLK)
   05220 Chronic myeloid leukemia
    102269608 (POLK)
   05217 Basal cell carcinoma
    102269608 (POLK)
   05218 Melanoma
    102269608 (POLK)
   05213 Endometrial cancer
    102269608 (POLK)
   05224 Breast cancer
    102269608 (POLK)
   05222 Small cell lung cancer
    102269608 (POLK)
   05223 Non-small cell lung cancer
    102269608 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102269608 (POLK)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     102269608 (POLK)
DNA repair and recombination proteins [BR:bom03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    102269608 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 102269608
NCBI-ProteinID: XP_005890151
LinkDB
Position
Un
AA seq 876 aa
MGSTKEKSDGTKEKNDNYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNE
LKKEKQVNQRIENMMQQKAKITSEQLRKAQLQVDRFAVELEQSRDLNSTIVHIDMDAFYA
AVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDK
YQAVSREVKEILTDYDPNFMAMSLDEAYLNITKHLEERKNWPEDKRKYFITAGNSLENDK
PGKEVNELSEHEGSISPLLFEDSPPDLQSPGNPSQVNFEEPNNPQIHQNSIVFGTSAEEV
VKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRK
VSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHHFLHISLGLGSTHLARDGER
KSMSVERTFSEISKAEEQYSLCQELCSELAQDLQKKGLKGRTVTIKLKNVNFEVKTRAST
VSTVVSTAEEIFVIAKELLRTEIDADFPQPLRLRLMGVRLSGFPNEEEKKHQQRSIIGFL
QPGNQALSATGCILEKTDKDQFLKPAQMSHKKSFFDKKRSERKASPQDTFTCETVNKQSL
QTSQSFQVLNKKMSENLETEEKSHSCQTFTCPVCFREQGSVSLEAFNKHVDACLDGPSIS
GNSKMSSCSHASSTEVNEKENVCDSVSLCEKQGYETHQKNTEITSVDPIELVETTGKPSN
TEDTSALSNKPSEEECSGLSSKLFNMDPQNSCTVSLENEDVGSLRRQESPQPNLYEVISD
QVLVCPVCNLEQKTSDLTLFNVHVDVCLNKGIIQELRKDKINPCNQPKESAKSTDNSGKA
QKTGNKTKRPGLMTKYSASKKTKPNNPRHTLDVFFK
NT seq 2631 nt   +upstreamnt  +downstreamnt
atgggtagcacaaaggagaagagtgatggcacaaaggagaagaatgacaattacaaagac
gatcttctgcttaggatgggacttaatgataataaagctggaatggaaggattagacaaa
gagaaaatcaacaaaattataatggaagccacaaagggatccagattttatggaaatgag
ctcaagaaagaaaagcaagtcaaccaacgaattgaaaatatgatgcaacaaaaagctaaa
attaccagcgaacagctaaggaaagcacaattacaggttgacagatttgcagtggaattg
gagcagagccgggatctgaacagcaccatagtgcacattgacatggacgctttctacgca
gctgtagaaatgagggacaatccagagctgaaggataaacccattgctgtaggatcaatg
agtatgctgtctacttcaaattaccacgcaaggagattcggtgttcgtgcagccatgcca
ggatttattgctaaaagactctgcccacagcttattatagtgcccccaaactttgacaaa
taccaagctgtgagtagagaggttaaggaaatccttactgattatgaccccaattttatg
gccatgagtcttgatgaagcctacctgaatataacaaagcatttagaggaaagaaaaaat
tggcctgaggacaaaaggaagtatttcatcacagcagggaactctctagaaaacgataaa
ccaggaaaggaagttaatgaactgagtgagcatgaaggatccatctctccactccttttt
gaagatagtcctcctgatttgcagtccccaggaaatccttcccaagtgaactttgaagag
ccgaataatcctcaaatacaccaaaactcaattgtttttggaacatcagcggaggaagtg
gtaaaggaaattcgtttcagaatcgagcagaaaacaacactcacagccagtgcaggcatt
gcacccaatacgatgttagcaaaagtatgcagtgataagaataaaccaaacggacaatac
caaattctacctaacaggcaagctgtaatggacttcattaaggacttacccattagaaag
gtttctggaataggaaaagttacagagaaaatgttaaaggcccttggaattattacttgt
acagaactgtaccaacagagggcattactttctctccttttctctgaaacatcttggcat
cattttcttcatatttccctgggtctaggttcaacacacctggcaagggatggagagagg
aaaagcatgagtgttgagaggacattcagtgagataagtaaagcagaagaacagtacagc
ttgtgccaagaactttgcagtgaacttgctcaagatctacagaaaaaaggacttaagggt
agaactgttaccattaagctaaagaatgtgaattttgaagtaaaaactcgtgcctctaca
gtttcaactgttgtttcaactgcagaagaaatatttgttatagctaaagaactgctaaga
acagaaattgatgctgattttccacaacccttgagattaagacttatgggggtgcggctc
tctggttttcccaatgaagaggagaagaaacaccaacaaaggagcattattggcttctta
cagcctggaaaccaagccctttcagccaccgggtgtatattagagaaaactgacaaagat
cagtttctaaaacctgcacaaatgtctcataagaagagtttctttgataaaaaacgatct
gaaaggaaagcgagcccccaagacacatttacatgtgaaaccgtaaataaacaaagtttg
caaacatcacagtcattccaggttttaaacaagaagatgagtgagaatttagaaacagag
gagaaatcacatagctgtcagacatttacctgtcctgtctgctttagggagcaaggaagc
gtcagtctggaagcctttaataaacatgtagatgcatgtcttgatggaccttccatcagt
ggaaactccaaaatgtcctcgtgttcacacgcttcctctacagaagtaaacgagaaagaa
aatgtatgtgattctgtctctctctgtgagaagcagggttatgaaacccaccagaagaat
acagagatcacgtcagtagatcctatagagctggtagagactaccggtaaaccatcaaat
acagaagatacaagtgctttaagtaataagcccagtgaagaggaatgttctggtctttca
agcaaattatttaatatggatcctcagaattcttgtactgtttcattggaaaatgaagat
gttgggtcattaagaaggcaagaatccccccaacctaatttatatgaagtaatcagtgac
caagttctagtttgtcctgtttgtaacctagaacaaaagacttcagatcttaccctattc
aatgtgcatgtagatgtttgcttaaataaaggcattatccaggaactgagaaaggataag
attaatccatgtaaccaacccaaagaaagcgccaaaagtactgataactcaggcaaagcg
cagaagactggaaacaaaacaaaaaggccaggattgatgacaaagtactcagcatcaaag
aaaacaaaaccaaacaatcccagacacactcttgatgtattttttaaatga

DBGET integrated database retrieval system