KEGG   Bos mutus (wild yak): 102269813Help
Entry
102269813         CDS       T02919                                 

Definition
(RefSeq) cationic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04080  Neuroactive ligand-receptor interaction
bom04972  Pancreatic secretion
bom04974  Protein digestion and absorption
bom05164  Influenza A
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102269813
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102269813
   04974 Protein digestion and absorption
    102269813
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    102269813
Enzymes [BR:bom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102269813
Peptidases [BR:bom01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102269813
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102269813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 102269813
NCBI-ProteinID: XP_005911218
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MKTFIFLAVLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVAEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGSNYPDVLQCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGYGCAQKNKPGVYTKVCNYVSWIK
QTIASN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatctttctggctgtcttgggagccgctgttgctttccccgtggacgat
gatgacaagatcgtgggcggctacacctgtggggcaaatactgtcccctaccaagtgtcc
ctgaactctggctaccacttctgcgggggctccctcatcaacagccagtgggtggtgtct
gcggctcactgctacaagtccggaatccaagtgcgtctgggagaagacaacattaatgtc
gctgagggcaatgagcaattcatcagcgcatccaagagcatcgtccatcccagctacaac
tcaaacaccttaaacaacgacatcatgctgattaaactgaaatcagctgccagtctcaac
agccgagtagcctctatctctctgccaacatcctgtgcctctgctggcacccagtgtctc
atctctggctggggcaacaccaaaagcagtggcagtaactaccctgatgtcctgcagtgt
ctgaaggctcccatcctatcagacagctcttgcaaaagtgcctacccaggccagatcacc
agcaacatgttctgtgcgggctacctggagggcggaaaggactcctgccagggtgactcc
ggtggccctgtggtctgcagtggaaagctccagggcattgtctcctggggctatggctgc
gctcagaaaaacaagcctggtgtctacaccaaggtctgcaactacgtgagctggattaag
cagaccatcgcctccaactaa

DBGET integrated database retrieval system