Bos mutus (wild yak): 102269967 Help Entry 102269967         CDS       T02919                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism bom  Bos mutus (wild yak) Pathway bom04010   MAPK signaling pathway bom04014   Ras signaling pathway bom04015   Rap1 signaling pathway bom04024   cAMP signaling pathway bom04062   Chemokine signaling pathway bom04510   Focal adhesion bom04520   Adherens junction bom04611   Platelet activation bom04670   Leukocyte transendothelial migration bom04720   Long-term potentiation bom04722   Neurotrophin signaling pathway bom04934   Cushing syndrome bom04972   Pancreatic secretion bom05211   Renal cell carcinoma bom05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102269967    04014 Ras signaling pathway     102269967    04015 Rap1 signaling pathway     102269967    04024 cAMP signaling pathway     102269967  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102269967    04520 Adherens junction     102269967  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102269967    04670 Leukocyte transendothelial migration     102269967    04062 Chemokine signaling pathway     102269967   09154 Digestive system    04972 Pancreatic secretion     102269967   09156 Nervous system    04720 Long-term potentiation     102269967    04722 Neurotrophin signaling pathway     102269967  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     102269967   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102269967   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102269967  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102269967    04031 GTP-binding proteins [BR:bom04031]     102269967 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102269967   Exosomal proteins of other body fluids (saliva and urine)    102269967   Exosomal proteins of colorectal cancer cells    102269967 GTP-binding proteins [BR:bom04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     102269967 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU G-alpha MMR_HSR1 Motif Other DBs NCBI-GeneID:  102269967 NCBI-ProteinID:  XP_005888415 LinkDB All DBs Position Un AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTHDVPMILVGSKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacacgcatgatgttccaatgattctggttggtagtaagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system