KEGG   Bos mutus (wild yak): 102270322Help
Entry
102270322         CDS       T02919                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00010  Glycolysis / Gluconeogenesis
bom00051  Fructose and mannose metabolism
bom00052  Galactose metabolism
bom00500  Starch and sucrose metabolism
bom00520  Amino sugar and nucleotide sugar metabolism
bom00524  Neomycin, kanamycin and gentamicin biosynthesis
bom01100  Metabolic pathways
bom01200  Carbon metabolism
bom04066  HIF-1 signaling pathway
bom04910  Insulin signaling pathway
bom04930  Type II diabetes mellitus
bom04973  Carbohydrate digestion and absorption
bom05230  Central carbon metabolism in cancer
Module
bom_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bom_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102270322 (HK1)
   00051 Fructose and mannose metabolism
    102270322 (HK1)
   00052 Galactose metabolism
    102270322 (HK1)
   00500 Starch and sucrose metabolism
    102270322 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102270322 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102270322 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102270322 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102270322 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102270322 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    102270322 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102270322 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102270322 (HK1)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102270322 (HK1)
Membrane trafficking [BR:bom04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102270322 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD UvrD-helicase
Motif
Other DBs
NCBI-GeneID: 102270322
NCBI-ProteinID: XP_005904298
LinkDB All DBs
Position
Un
AA seq 840 aa AA seqDB search
KGDFIALDLGGSSFRILRVQVNHEQNQAVHMESEVYDTPENIMHGSGSQLFDHVAECLGD
FMEKKKIKDKKLPVGFTFSFPCRQSRIDEAILITWTKRFKASGVEGTDVVKLLDKAIKKR
GDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMC
VNTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKE
GLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVAVXVCPI
VSFRSANLVAATLGAILSRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPD
CDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFSLTKEMLLEVKKRMRAEMEL
GLGKQTHDKAVVKMLPSFVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRSVEMHN
KIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPKMPLGFTFSFPCKQTSLDAGILI
TWTKGFKATDCVGHDVATLLREAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLI
VGTGSNACYMEEMKNVETLEGNQGQMCINMEWGAFGDNGCLDDIRTIYDKLVDEFSLNSG
KQRYEKMISGMYLGEIVRNILIDFAKRGFLFRGQISEPLKTRGLFQTKYLSQIESDRLAL
LQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAAVVDKIRENRGLDRLNVT
VGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRQEMSS
NT seq 2525 nt NT seq  +upstreamnt  +downstreamnt
aaaagggagatttcatcgccctggatcttggcggatcttcctttcgaattctgcgggtgc
aagtgaatcacgagcagaaccaggctgttcatatggagtctgaggtttacgacaccccgg
agaacatcatgcatggcagtggaagccagctttttgatcacgtcgctgagtgcctgggag
acttcatggagaaaaaaaaaatcaaggacaagaaattacctgtgggattcacgttttctt
tcccttgtcggcaatccagaatagacgaggccatcctgatcacctggacaaagagattta
aagcgagcggcgtggagggaactgatgtggtgaagctgcttgacaaagccatcaaaaagc
gtggggactatgatgccaacattgtggctgtggtgaacgacacggtggggaccatgatga
cctgtggctacgacgaccagcagtgtgaagtcggcctcatcattggtaccggcaccaacg
cgtgctacatggaggagctgagacacatcgacctggtggagggcgacgaggggaggatgt
gcgtcaacaccgagtggggggcctttggggacgacggggccctggaggacatccgcaccg
agttcgaccgggagatagaccgggggtcgctcaaccccgggaagcagctgtttgagaaga
tggtcagtggcatgtacctgggcgagctggtccgactgatcctggtcaagatggccaagg
agggcctcttatttgaagggcggatcaccccagagctgctcaccagagggaagtttaaca
ccagtgacgtgtcggccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcc
tgacccgcctgggagtggagccgtctgatgacgactgtgttgcggttnacgtgtgcccca
tcgtctcatttcgctctgccaacctggtggcggcgaccctgggtgccatcttgagccgcc
ttcgagataacaagggcacgcccaggctgcggaccacggttggtgtcgacgggtcccttt
acaagacgcacccacagtattctcggcgtttccacaagactctgcggcgcttggtacccg
actgtgatgtgcgtttcctcctctccgagagcggcagtggcaagggggccgccatggtga
ctgccgtggcctaccgcctggctgagcagcaccggcagatagaggagaccctggcccact
tcagcctcaccaaggaaatgctgctggaggtgaaaaagcggatgcgggctgagatggaat
tggggctgggcaagcagacgcatgacaaggctgtggtcaagatgttgccctccttcgtcc
ggagcactcctgatgggactgagaacggtgacttcttggccctggatcttggaggaacga
atttccgtgtcctgctggtgaaaatccgtagtgggaaaaagagatcggtggaaatgcaca
ataagatctacgccattcccattgaaatcatgcagggcactggggaggagctgtttgacc
acatcgtttcctgcatctctgacttcctggactacatgggcatcaagggccctaaaatgc
ctctgggcttcacattttcgtttccctgcaagcagacgagcttagatgcgggtatcttaa
tcacctggaccaaaggttttaaggcaaccgactgcgtggggcatgatgtagcaaccttac
tgagggaggcgataaaaaggagagaggaatttgacctggatgtggtggctgtggtcaacg
acacggtgggcaccatgatgacctgtgcttatgaggagcccacctgcgaggttggactca
tcgtagggactggcagcaatgcctgctacatggaggaaatgaaaaacgtcgagacgctag
aaggaaaccagggacaaatgtgtatcaacatggagtggggtgcctttggggacaacgggt
gtctggatgatatcagaacaatctatgacaaactggtggatgagttttctctaaactctg
ggaagcaaaggtatgagaagatgatcagcggtatgtacctgggtgagattgtccgcaaca
tcttgatcgacttcgccaagaggggcttcctcttccgggggcagatctctgagccgctga
agacccggggcctctttcagaccaagtatctctctcagatcgagagcgaccgattagcgc
tgctgcaggtccgggccatcctccagcagctgggcctgaacagcacgtgcgacgacagta
tcctcgtgaagaccgtgtgtggggtggtgtccaagagggcggcgcagctgtgtggcgcag
gcatggctgctgtggtggataagatccgcgaaaacagggggctggaccgcctcaacgtga
ctgtgggcgtggacgggacgctctacaagcttcatccgcacttctccagaatcatgcacc
aaaccgtgaaggaactgtcaccaaagtgtaatgtgtccttcctcttatctgaagacggca
gcggcaaaggagccgccctcatcacagcagtgggcgttcggctccggcaagaaatgagca
gctaa

DBGET integrated database retrieval system