KEGG   Bos mutus (wild yak): 102270403
Entry
102270403         CDS       T02919                                 

Definition
(RefSeq) TATA-box-binding protein
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
bom  Bos mutus (wild yak)
Pathway
bom03022  Basal transcription factors
bom05016  Huntington disease
bom05017  Spinocerebellar ataxia
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    102270403
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102270403
  09164 Neurodegenerative disease
   05016 Huntington disease
    102270403
   05017 Spinocerebellar ataxia
    102270403
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102270403
   05165 Human papillomavirus infection
    102270403
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102270403
   03021 Transcription machinery [BR:bom03021]
    102270403
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    102270403
Transcription machinery [BR:bom03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     102270403
  RNA polymerase III system
    TFIIIB
     102270403
  RNA polymerase I system
    SL1/TIF-1B
     102270403
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 102270403
NCBI-ProteinID: XP_005900431
LinkDB
Position
Un
AA seq 288 aa
MDRNDSLSPFDQDLTSPQGAMSPGIPVFSPMMHYGTGLTPQPIQSTDSLSTSEEEQQQTT
QATQEALDQTPQLFDSQPLTTAPLLGTTPLYPSPMIPMTPAMPASEIAELVPQLHNVVCT
VNLGCKLDLKSIALLARNAEYNPKRFAAVIMRIREPRTTALLFSSGKMVCTGGKSEEQSR
LAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEPLVLSHQQFASYEPELFPGL
VYRMIKPRIVLLIFVSGKVVLTGAKVRSEIYEAFNNIYSILKGFRKTS
NT seq 867 nt   +upstreamnt  +downstreamnt
atggatcggaatgatagcctctctccgtttgaccaggatctgacctcccctcaaggtgcc
atgagtcctggaatccctgtcttcagtccaatgatgcattatggcacaggactgactccg
cagccaattcagagcaccgacagtctgtctacttcagaggaggagcagcagcagacgacg
caggcaacccaggaggccttggaccagacaccacagctcttcgactcacagcctcttacg
accgcacccttgctgggtaccactcccctgtatccatcccccatgatccccatgacccct
gccatgccagcctcagagatcgctgagttggtgccacagctgcacaatgttgtatgcaca
gtgaatcttggttgtaaacttgacctaaagagcattgcccttcttgctcgaaatgctgaa
tataatcccaagaggtttgctgctgtaatcatgagaataagagagccccgaaccactgca
cttttattcagttctgggaagatggtgtgcacaggaggcaagagtgaagaacagtccagg
ctagcagcaagaaaatatgccagaatcatacagaagttgggttttccagctaagttcttg
gacttcaagattcagaacatggtggggagctgtgatgtgaagttccccataaggttagaa
ccccttgtgcttagccaccaacagttcgctagttatgagccagagttatttcctggttta
gtctacagaatgatcaaaccgagaattgttctccttatctttgtctctggaaaagttgtg
ttaacaggtgctaaagtcagaagtgaaatttatgaagcctttaataacatctactctatt
ctaaagggtttcaggaagacatcgtaa

KEGG   Bos mutus (wild yak): 102271474
Entry
102271474         CDS       T02919                                 

Gene name
TBPL1
Definition
(RefSeq) TATA-box binding protein like 1
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
bom  Bos mutus (wild yak)
Pathway
bom03022  Basal transcription factors
bom05016  Huntington disease
bom05017  Spinocerebellar ataxia
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    102271474 (TBPL1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102271474 (TBPL1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102271474 (TBPL1)
   05017 Spinocerebellar ataxia
    102271474 (TBPL1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102271474 (TBPL1)
   05165 Human papillomavirus infection
    102271474 (TBPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102271474 (TBPL1)
   03021 Transcription machinery [BR:bom03021]
    102271474 (TBPL1)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    102271474 (TBPL1)
Transcription machinery [BR:bom03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     102271474 (TBPL1)
  RNA polymerase III system
    TFIIIB
     102271474 (TBPL1)
  RNA polymerase I system
    SL1/TIF-1B
     102271474 (TBPL1)
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 102271474
NCBI-ProteinID: XP_005887805
UniProt: L8J057
LinkDB
Position
Un
AA seq 186 aa
MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI
WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF
TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE
SRKEIL
NT seq 561 nt   +upstreamnt  +downstreamnt
atggatgcagacagtgatgttgcactggacattctaattacaaatgtagtatgtgttttt
agaacaagatgccatttgaacttaaggaagattgctttagagggagcaaacgtaatttat
aagcgtgatgttggaaaagtattaatgaagcttagaaagcctagaattacagctacaatt
tggtcctcaggaaaaattatttgcactggagcaacaagtgaagaagaagctaaatttggt
gccagacgtttagcccgtagtctccagaaactaggatttcaggtaatatttacagatttt
aaggttgttaacgttttggcagtgtgtaacatgccgtttgaaatccgtttgccagaattc
acaaagaacaatagacctcatgccagttacgaacctgagcttcatcctgctgtgtgctat
cggataaaatcgctaagagctacattacagattttttcaacaggaagtatcacagtaaca
ggacccaatgtaaaggctgttgctactgctgtggaacagatttacccatttgtgtttgaa
agcaggaaagagattttataa

KEGG   Bos mutus (wild yak): 102272125
Entry
102272125         CDS       T02919                                 

Gene name
TBPL2
Definition
(RefSeq) TATA-box binding protein like 2
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
bom  Bos mutus (wild yak)
Pathway
bom03022  Basal transcription factors
bom05016  Huntington disease
bom05017  Spinocerebellar ataxia
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    102272125 (TBPL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102272125 (TBPL2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102272125 (TBPL2)
   05017 Spinocerebellar ataxia
    102272125 (TBPL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102272125 (TBPL2)
   05165 Human papillomavirus infection
    102272125 (TBPL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102272125 (TBPL2)
   03021 Transcription machinery [BR:bom03021]
    102272125 (TBPL2)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    102272125 (TBPL2)
Transcription machinery [BR:bom03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     102272125 (TBPL2)
  RNA polymerase III system
    TFIIIB
     102272125 (TBPL2)
  RNA polymerase I system
    SL1/TIF-1B
     102272125 (TBPL2)
SSDB
Motif
Pfam: TBP
Other DBs
NCBI-GeneID: 102272125
NCBI-ProteinID: XP_005905117
LinkDB
Position
Un
AA seq 345 aa
SPPPMEETYLELYLDQCSAQDALTPSRSPLLSPAVPYDVDMLTSSNPETAFNPQLEEVTE
ASGSFSAVDLSFLPDELSQENKDQTVIRSKHEVEENCKTPSRQIRLPLPSQLDAGLALNS
SSGSGSHSHLHPADGNSAQPSPEKPHSMPLASITPMTPMAPISECSGIVPQLQNIVSTVN
LACKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLA
ARKYARVVQKLGFPARFLDFTIQNMVASCDVRFPISLEGLVLTHQQFSSYEPELFPGLIY
RMVKPRIVLLIFVSGKVVLTGAKKRSDIYEAFENIYPILKGFKKA
NT seq 1040 nt   +upstreamnt  +downstreamnt
tgagccctccacccatggaggagacatacctggagctctacttggaccagtgctccgccc
aggatgcccttacgccatccagatcacccctgctgagcccagctgtgccttatgatgtgg
acatgcttacgtcatccaatccagagactgcatttaatccccagcttgaagaagtcacag
aagcatctggcagtttctcagctgtggatcttagcttcttaccagatgagctctcccaag
aaaataaagaccagactgtcattaggagcaagcatgaagttgaagaaaactgtaaaactc
caagtcggcaaattaggttgcccttacccagccaactggacgctggcctggccttaaaca
gcagcagtgggtcaggttcccattcacatctgcaccctgctgatggtaactcagcccagc
cctctcctgagaaaccacactccatgcctctggcgtccataactcctatgacaccaatgg
cccctatttcagaatgttctggaattgtgcctcaactacagaacatagtttccactgtaa
acctggcctgtaaattggatctgaagaaaatagctttgcatgcaaaaaacgcagaatata
acccaaagagatttgccgctgtcataatgaggatccgagagcccaggactacagccctca
tatttagctctgggaaaatggtctgcacaggagccaaaagcgaagagcagtctcgacttg
cagcgaggaagtacgcccgtgtggtgcagaagctgggctttcctgccagattcctcgatt
ttacaattcagaacatggttgcaagctgtgatgtgagatttcctatcagtctggaaggtt
tggtgctaacccatcagcagttcagtagttatgaacctgaactgtttcctggccttattt
atagaatggtgaaaccacgaattgtgttgcttatctttgtatctggaaaagttgtgctga
caggtgccaaaaaacgttctgacatctatgaagcatttgaaaacatctatcctattctaa
agggttttaaaaaagcctga

KEGG   Bos mutus (wild yak): 102283352
Entry
102283352         CDS       T02919                                 

Gene name
TBP
Definition
(RefSeq) TATA-box binding protein
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
bom  Bos mutus (wild yak)
Pathway
bom03022  Basal transcription factors
bom05016  Huntington disease
bom05017  Spinocerebellar ataxia
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    102283352 (TBP)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102283352 (TBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102283352 (TBP)
   05017 Spinocerebellar ataxia
    102283352 (TBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102283352 (TBP)
   05165 Human papillomavirus infection
    102283352 (TBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102283352 (TBP)
   03021 Transcription machinery [BR:bom03021]
    102283352 (TBP)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    102283352 (TBP)
Transcription machinery [BR:bom03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     102283352 (TBP)
  RNA polymerase III system
    TFIIIB
     102283352 (TBP)
  RNA polymerase I system
    SL1/TIF-1B
     102283352 (TBP)
SSDB
Motif
Pfam: TBP TPX2 ANAPC_CDC26 Spt20 TFIIA
Other DBs
NCBI-GeneID: 102283352
NCBI-ProteinID: XP_005908739
UniProt: L8HST9
LinkDB
Position
Un
AA seq 312 aa
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQ
QQQQQQQQQAAVAAVQQSTSQQATQGPSGQTPQLFHSQTLTTAPLPGTPPLYPSPMTPMT
PITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREP
RTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFP
IRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFEN
IYPILKGFRKTT
NT seq 939 nt   +upstreamnt  +downstreamnt
atggatcagaacaacagcctcccaccctatgcccagggcctggcctcccctcagggtgcc
atgactcctggaatccctatctttagtccaatgatgccttacggcacaggactgactcca
cagcctattcagaacaccaacagtctgtctattctggaggagcagcaacggcagcagcag
cagcagcagcaacagcagcagcagcaggcggcagtggcagccgtccagcagtcgacgtcc
cagcaggcaacccaggggccctcgggccagacaccacagctcttccactcacagactctt
acgactgcacccttgccgggcacccctcccttgtatccctcccccatgacccccatgacc
cccatcacccctgccacgccagcctcagagagctccgggatcgtgccgcagctgcaaaat
attgtatccacagtgaatcttggttgtaaacttgacctaaagaccattgcacttcgtgcc
cgaaatgctgaatataatcccaagcgttttgctgctgtaatcatgagaataagagagccc
cgcaccactgcactgatattcagttctgggaagatggtgtgcacaggagccaagagtgaa
gaacagtctagactagcagcaagaaaatacgccagagttgtacagaaactgggttttcca
gctaagttcttggacttcaagattcagaacatggtggggagctgtgatgtgaagttccct
ataaggttagaaggccttgtgcttacccaccaacagttcagtagttatgagccagagtta
tttcctggtttaatctacagaatgatcaaaccgagaattgttctccttatttttgtttct
ggaaaagttgtattaacaggtgctaaagtcagagcagaaatttatgaagcctttgagaac
atctaccctattctgaagggtttcaggaagacaacgtaa

DBGET integrated database retrieval system