KEGG   Bos mutus (wild yak): 102270607
Entry
102270607         CDS       T02919                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04066  HIF-1 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04370  VEGF signaling pathway
bom04510  Focal adhesion
bom04926  Relaxin signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05219  Bladder cancer
bom05323  Rheumatoid arthritis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102270607 (VEGFA)
   04014 Ras signaling pathway
    102270607 (VEGFA)
   04015 Rap1 signaling pathway
    102270607 (VEGFA)
   04370 VEGF signaling pathway
    102270607 (VEGFA)
   04066 HIF-1 signaling pathway
    102270607 (VEGFA)
   04020 Calcium signaling pathway
    102270607 (VEGFA)
   04151 PI3K-Akt signaling pathway
    102270607 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102270607 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102270607 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102270607 (VEGFA)
   05206 MicroRNAs in cancer
    102270607 (VEGFA)
   05205 Proteoglycans in cancer
    102270607 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102270607 (VEGFA)
   05211 Renal cell carcinoma
    102270607 (VEGFA)
   05219 Bladder cancer
    102270607 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102270607 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102270607 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102270607 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102270607 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102270607 (VEGFA)
   05165 Human papillomavirus infection
    102270607 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102270607 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102270607 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102270607 (VEGFA)
Cytokines and growth factors [BR:bom04052]
 Growth factors
  Growth factors (RTK binding)
   102270607 (VEGFA)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102270607 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF CXCXC
Other DBs
NCBI-GeneID: 102270607
NCBI-ProteinID: XP_014335016
LinkDB
Position
Un
AA seq 186 aa
MAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCND
ESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQEKKSVRGKGK
GQKRKRKKSRYKSWSAPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCR
CDKPRR
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcagaaggagggcagaaaccccacgaagtggtgaagttcatggatgtctaccagcgc
agcttctgccgtcccatcgagaccctggtggacatcttccaggagtacccagatgagatt
gagttcattttcaagccgtcctgtgtgcccctgatgcggtgcgggggctgctgtaatgac
gaaagtctggagtgtgtgcccactgaggagttcaacatcaccatgcagattatgcggatc
aaacctcaccaaagccagcacataggagagatgagcttcctacagcataacaaatgtgaa
tgcagaccaaagaaagataaagcaaggcaagaaaaaaaatcagttcgaggaaagggcaaa
gggcaaaaaagaaagcgcaagaaatcccggtataaatcctggagcgctccctgtgggcct
tgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgtaaatgttcctgc
aaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaacgtacttgcaga
tgtgacaagccaaggcggtga

DBGET integrated database retrieval system