KEGG   Bos mutus (wild yak): 102270662Help
Entry
102270662         CDS       T02919                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00052  Galactose metabolism
bom00500  Starch and sucrose metabolism
bom01100  Metabolic pathways
bom04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102270662 (MGAM2)
   00500 Starch and sucrose metabolism
    102270662 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102270662 (MGAM2)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102270662 (MGAM2)
    3.2.1.20  alpha-glucosidase
     102270662 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102270662
NCBI-ProteinID: XP_014338977
LinkDB All DBs
Position
Un
AA seq 2151 aa AA seqDB search
MARKLSALEILLIIFIIIVLAVDILFLMLLLEKPSGASFVPECPEIPESERIDCAPGQEV
TEDVCRQRYKCCWKPVPDTAIPWCFFPRNWGYEISNLVKNTSTEYEAQLRRLPSPSLFGY
DVIDTLFTAEYQTSNRFHFKITDFNNMRYEVPHENVKLFDGNADASNLSYHLEVIHKPFS
IKIMRTSNKRVLLDTSIGPLQFAQQYLQLSMRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEVTLQPAPAVTYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRNYGGIDGLKNVVNRTREAEI
PYDVQYSDIDYMDEKKDFTIDGVAFHGLSDFAKKLHENGLKYVIIMNPGILNNSDYQPYV
NGSRKRVWILGDKGFVVGQAYPGWTVFPDFTNPDCTEWWKEQFSEFYKTLEFDGVWIEMD
EVSSFLQSSDQDCEVNNFNFPPFKPRVLDHLLFARTLCMDTEFHGGFHYDVHSLYGYTMA
KATDSAMENIFRNKRRFILSRSTFAGSGKFAAHWLGDNAARWDDLRWSIPGILEFNLFGI
PMVGANICGYRENVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFSENNAMLLESSR
YYLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVL
YEGLNYARAYIPDAIWYDYETQVAIEWRKQFVEMLLPGDRIGLHLRGGYIFPIQQPNTTT
ETSRKNSLGLIIALDSKREAKGELYWDDGVSKDAVTGNNSILYKFSITSNRLQATIIHAN
YTDPDKLTFTDIMILGMDKEPTNFTVSLNDVTTSISNVVYTESTKVVNITDLEGLVLGQA
FSIQWDLPVSDLQKFNCFPEQPAVSEESCRERGCLWEPTTVPGVPTCFYDTIPNYAASNI
QYLPTGITDKLSPPAAAAKAASASDTLSATIGFLRLSVTYHTENMLQFKIYDPTNKRYEV
PVPLNTPSSPVGSPENCLYDVKIQNNPFGIQIRRKSSSTVIWDSQLPGFTFRDMFLSIST
RLPSQYLYGFGETEHTTFRRNISWHTWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAHG
VLXLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGRPAMIPYWAL
GFQLSRYGYQDDYEISSLYVAMMAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLGLLIEQ
MKKNGTRFVLVLDPAISGNETQYLTFTRGKESDVFIKWPDNSDIVWGKVWPDLPNVNVDG
SLDHETQVKLYKAHVAFPDFLRKSTAAWWKREIEELYRNPREPEKSLKFDGLWINMNEPS
NFVNGSVRGCSDEILNNPPYVPYLESRDRGLSSRTLCMESQQVLPDGSPVRHYDVHSLYG
WAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNRAAWDQLKKSIIGMMEFSL
FGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNTFGTRRQDPVAWDSDFEMFSR
KVLQTRYTLLPYLYTLMHKAHAEGSTVVRPLLHEFTEERTTWDIDHQFMLGPAVLISPVL
ENNTFQVQAYFPRARWYDYSTGSGNESTGEWKVLEAPLDHINLHIRGGYILPWQEPAMNT
YSSRQKYMGLIVALDDNGRAEGQLFWDDGQSIDTFENGNYFLVNFTAAQSVLQIQMIHNN
YLSDTNSLKVGYIRIWGINSTDIIQVTVSYDNQQFMVMNFKSDPYNQTLNIQLTDKIISL
EKLTEITWIHGGPIVSTTTMTSTFPMSSLHPPTTSTTAATSVTTSSSTPSSTSTTDSSSA
ALPMTTTSFPTSATEVSTGTTVPNTSTSFPPNTATDSTSVILPITTMHYPTSATEVSTSV
TVPNTTISSPIHTTLDSTDSTLPITDTPYTTSATQVSTSTTVPNATISSPINTTADSTNV
TLPVTTMPYITTTAEVSTSTTVPNATISSPIHTTLDSTDSTLPITDTPYTTSATQFSTST
TVPNATISSPIHTTLDSTDSTLPITDTPYTTSATQFSTSTTVPNATISSPINTTTHSTNV
TLPVTTMPYITTTAEVSMSTTVPNATISSPIHTTLDSTDSFDDALVVMVLR
NT seq 6456 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagcttagtgcattggaaatcctcctgatcatcttcatcataattgtactt
gctgtagatatcctctttctgatgcttctgttggagaagccttcaggtgcttcatttgtt
ccagagtgcccagaaatccccgaatcggaaaggatagactgtgcccctggccaggaggtg
acagaggatgtctgccgacagagatataagtgctgctggaaacctgtgccagatactgcc
atcccctggtgcttcttccccaggaactggggctacgaaatcagcaatttggttaaaaat
acaagcacagagtatgaggcccagttgagaaggctgccatcaccatctctgtttggatat
gatgtaatcgacaccctcttcacagctgaatatcagacatccaatcgtttccattttaag
atcactgatttcaataacatgcgctatgaagtcccccatgaaaatgttaagctctttgat
gggaatgctgatgcttccaatttgagctatcatctagaagtcattcacaaacccttcagc
atcaagataatgaggactagcaacaaaagagtcttgttggacaccagcattgggcccctc
cagtttgcccagcagtacctgcagctctccatgcgactgcccagtgccaacgtgtacggg
ctgggcgaacacgtgcaccagcagtaccgccacaacatgacctggaagacctggcccatc
ttcaccagggatgccacccctaccgagggcatgattaatctatatggagctcacacattc
ttcttgtgcctagaagacaccagcggcttctctttcggggtttttctgatgaacagtaac
gccatggaggtcacccttcagcccgctcctgctgtcacttaccgcacgatcgggggtatt
cttgacttctatgtgttcctgggaaatactccagaacaagtggttcaggaatacctggag
cttgttggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgcagg
aattatggtggtattgatggattgaaaaatgttgtaaaccgaactcgtgaagctgagatc
ccttatgatgtccagtactctgacatagactacatggatgaaaagaaggatttcactatt
gatggagtggctttccatggtctctcagattttgccaaaaagttacatgaaaatggactg
aaatatgtaattattatgaatcctggcatcttaaataactctgactaccagccttatgtg
aatggaagcagaaagagagtgtggatcttgggggacaaaggctttgttgttgggcaggca
tatcctggctggacagtttttcctgattttactaatccagattgtactgagtggtggaaa
gagcagttcagtgaattttataaaactctggagtttgatggagtgtggattgaaatggat
gaagtatctagctttctacaaagttctgatcaagactgtgaagtaaacaacttcaacttt
cctcctttcaaacctcgagttctggatcacttgcttttcgcaagaaccctctgcatggac
acagagtttcatgggggctttcactacgatgtccacagcttgtatggctacaccatggca
aaagccacagactcggccatggagaatatcttccgcaataagagacgcttcatcttatca
cgttctacttttgcgggatctggcaaatttgctgctcattggttgggggacaatgcagcc
agatgggacgatctccgatggtctatccctggtatcctggagttcaacctattcggcatc
cccatggtaggtgccaacatctgtggttatagagagaatgtcacagaggagctttgcaga
cggtggatgcagctgggagcattttatccactgtcgaggaatcacaacgggcctgggttc
agggaccaggatcctgctgccttcagtgaaaacaacgctatgctgttggaatcctccaga
tactatctgaacatccgctacaccctgctgccctatctctacacccttttctaccgagct
cataccctgggggagaccgtagcaaggcccctcgtccacgagttctaccaggacccagcc
acctgggaggtgcacgagcagttcctctgggggcctggactcctcatcacgcctgtttta
tatgaaggtttgaactatgcaagagcatacatacccgacgccatctggtacgactatgaa
acgcaagtagccatagaatggaggaaacaatttgtggagatgctgctgccaggtgatagg
ataggacttcacctccgagggggctacatctttcccatccagcagccaaacacgaccaca
gagaccagccggaagaactctctgggactcatcattgccttggactctaagcgagaagca
aagggagagctgtactgggatgatggtgtctctaaagatgctgtaactggaaataattct
attctgtataagttttccatcacctctaaccgtctacaggcaacgattatacatgctaat
tatacagaccctgacaaactcacatttacagatatcatgatcttgggaatggacaaggaa
cctactaattttactgtctccctaaatgatgtgaccacctccatttcaaatgttgtctac
acagaatcaacaaaggtggtgaacatcactgaccttgagggactggtactgggacaagca
ttctccattcagtgggatcttccagtcagtgacctgcagaagttcaactgctttcctgag
cagcctgctgtctccgaggagagttgcagggagcgggggtgcctttgggagccaacgact
gttcctggggtgcccacctgtttctatgacaccatccctaattatgctgccagcaacatt
cagtacctgcctacgggcatcactgacaagctatccccacctgcagctgcagcgaaggcc
gcctctgcctctgacactctctctgcaaccatcggctttctccgcctgagcgtgacctac
cacacagagaacatgctgcagttcaagatctatgatcccactaataaaaggtacgaggtc
ccagtgcctctgaacaccccttcgtctccagtgggctcccctgaaaactgtctgtatgat
gtcaagattcagaacaatccttttgggatccagattcgaagaaagagctccagcactgtg
atttgggactctcagctccctggcttcaccttcagggacatgttcctttccatctccaca
cgcctcccctctcagtacctctatggctttggggaaactgagcacacaactttcagaaga
aacataagctggcacacatggggaatgtttgcccgagatgagccaccagcgtataagaag
aactcctatggtgtccacccctactatatggcactggaggaggatggcagtgcccatgga
gtgctcncgctgaacagcaatgccatggatgtgacattccagcctactcctgccctgaca
taccgcaccacaggaggcattttggacttttatatggttttggggccaacccctgagctt
gtaactcagcaatacactgagttgattggtcggccagcaatgattccctactgggccttg
ggattccaactgagtcgctatggataccaggatgattatgaaatctccagtttgtatgtt
gcaatgatggctgctcagattccctacgatgtccagcatgtcgacatcgactacatggac
cggaagctggacttcactctcagccccagctttcaaaatcttggcctcctgattgagcaa
atgaagaaaaatggcacaagatttgttcttgttctggacccagccatttctggcaatgag
acccagtatctcacattcaccagagggaaggaaagtgatgtgttcatcaaatggccagac
aacagcgatattgtctggggaaaggtttggccagatctgcccaacgtgaatgtggatggg
tcccttgatcacgaaactcaggttaagttgtacaaagcccacgttgcctttcctgacttc
ttgcggaagagcactgctgcctggtggaagagggaaatagaagagctctacagaaaccct
cgagagccagagaagagcttgaagtttgatggactgtggattaacatgaatgaaccatcg
aactttgtaaatggatctgtcaggggctgcagtgatgaaattcttaataatccaccctat
gtgccatacttggagtcccgggaccggggcctgagcagcaggaccctgtgcatggagagc
cagcaggtgctgcccgatggctcaccggtgcgccactacgatgtgcacagcctttatggc
tgggcccagaccagacccacgtacgaagctgtgcaggaggtgacgggacagcgagggatc
gtcatcactcgctccactttcccctcttctggccgctggggaggacactggctgggcgac
aacagggccgcatgggaccagctgaagaagtcaatcattggcatgatggaattcagtctc
tttggaatctcttatacaggagcagacatctgtggattctttggagatgctgagtacgag
atgtgtgttcgctggatgcagctgggggcattttatccattttccaggaaccacaacaca
ttcgggaccaggagacaagatcctgtggcctgggactcagactttgagatgttctcaaga
aaagttctccagaccagatatactctgctgccctacctctatactctgatgcataaggct
cacgctgagggcagcactgtggtccgaccccttctccatgagtttacagaggaacgtaca
acatgggatatagaccatcagttcatgctgggccctgccgtcttaattagccccgtgctg
gaaaataatacttttcaggtccaggcttactttcccagagcccgttggtatgactatagc
acgggatctggcaatgaatcaacaggtgagtggaaagtcctggaggctcccctggaccat
atcaaccttcatatcagaggaggctacatcctgccttggcaagaacctgcgatgaacact
tactccagccgacagaaatatatgggattgattgttgctttggatgataatgggagagct
gaaggtcagctgttctgggatgatggacaaagcattgatacctttgaaaatggaaactat
ttcttggtaaactttacagcagctcagagtgtactgcaaatccaaatgatacataataat
tatttgagtgacactaattcactgaaagttggatatattagaatctggggcataaactct
actgatataatacaagtgactgtctcctatgacaatcaacaattcatggtgatgaatttc
aagagtgacccttacaatcagacactaaatattcaactgactgacaagattatcagcctg
gaaaagttaactgagattacttggattcacggtggtcctatagtttctactacaactatg
acgagtaccttcccaatgagttctttacatcctcctacaacttctactactgctgctact
tctgttaccactagttcttctactccaagtagcactagtactactgatagcagtagtgct
gctcttcctatgacaaccacttcttttccaacaagtgccactgaggtttcaactggtact
accgttcccaataccagtacatctttccctccaaatactgctactgatagcactagtgtt
attcttcccatcacaaccatgcattacccgacaagtgctactgaagtttcaactagtgtt
actgtccctaataccactatatcttcccctatacatacgactctggatagcactgatagt
actcttcctatcacagacacgccatacacaacaagtgctactcaagtttcaactagtact
actgtccctaatgccactatatcttcccctataaatactactgctgatagcactaatgtt
actcttccagtcacaaccatgccttacataacaactactgctgaagtttcaacgagtact
actgtccctaatgccactatatcttcccctatacatacgactctggatagcactgatagt
acgcttcctatcacagacacgccatacacaacaagtgctactcaattttcaactagtact
actgtccctaatgccactatatcttcccctatacatacgactctggatagcactgatagt
acgcttcctatcacagacacgccatacacaacaagtgctactcaattttcaactagtact
actgtccctaatgccactatatcttcccctataaatactactactcatagcactaatgtt
actcttccagtcacaaccatgccttacataacaactactgctgaagtttcaatgagtact
actgtccctaatgccactatatcttcccctatacatacgactctggatagcactgatagc
tttgacgacgccttagtcgtcatggtcttaagatga

DBGET integrated database retrieval system