KEGG   Bos mutus (wild yak): 102270836
Entry
102270836         CDS       T02919                                 

Gene name
C3
Definition
(RefSeq) complement C3
  KO
K03990  complement component 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04080  Neuroactive ligand-receptor interaction
bom04145  Phagosome
bom04610  Complement and coagulation cascades
bom05133  Pertussis
bom05134  Legionellosis
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05150  Staphylococcus aureus infection
bom05152  Tuberculosis
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05203  Viral carcinogenesis
bom05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102270836 (C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102270836 (C3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102270836 (C3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102270836 (C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102270836 (C3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102270836 (C3)
   05134 Legionellosis
    102270836 (C3)
   05150 Staphylococcus aureus infection
    102270836 (C3)
   05152 Tuberculosis
    102270836 (C3)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102270836 (C3)
   05168 Herpes simplex virus 1 infection
    102270836 (C3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102270836 (C3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102270836 (C3)
   05142 Chagas disease
    102270836 (C3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bom01002]
    102270836 (C3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102270836 (C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102270836 (C3)
Peptidases and inhibitors [BR:bom01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   102270836 (C3)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Phagocytosis
   Opsonins
    102270836 (C3)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102270836 (C3)
SSDB
Motif
Pfam: TED_complement MG1 A2M_recep A2M A2M_BRD MG4 NTR MG2 MG3 ANATO DUF4003 Imm49
Other DBs
NCBI-GeneID: 102270836
NCBI-ProteinID: XP_005890768
LinkDB
Position
Un
AA seq 1661 aa
MKPTSGPSLLLLLLASLPMALGNPMYSMITPNILRLESEETVVLEAHGGQGTIQVSVTVH
DFPAKKQVLSNENTQLNSNNGYLSTVTIKIPASKELKSDKGHKFVTVVATFGNVQVEKVV
LISLQSGYLFIQTDKTIYTPGSTVLYRVFTVDHKLLPVGQTVFITIETPDGIPVKRDSKS
SQNQFGILALSWNIPELVNMGVWKIKAYYEDSPQQVFSAEFEVKEYVLPSFEVQLEPEEK
FYYIDDPDGLKVNIIARFLYGEQVDGTAFVIFGVQDGDRRISLTHSLTRVPINDGNGEAI
LKRQVLLNGVQPSRADALVGKSIYVSATVILQSGSDMVEAERTGIPIVTSPYQIHFTKTP
KFFKPAMPFDLMVYVTNPDGSPARHIPVVTQGSNVQSLTQDDGVAKLSINTQNKRDPLTI
TVRTKKDNIPEGRQATRTMQALPYNTQGNSNNYLHLSVPRVELKPGETLNVNFHLRTDPG
EQAKIRYYTYMIMNKGKLLKVGRQYREPGQDLVVLPLTITSDFIPSFRLVAYYTLINAKG
QREVVADSVWVDVKDSCMGTLVVKNGGKEEKHHRPGQQITLKIEADQGARVGLVAVDKGV
FVLNKKNKLTQRKIWDVVEKADIGCTPGSGRNYAGVFTDAGLTLKTSQGLETQQRADPQC
PQPATRRRRSVQLMEKRMDKAGQYSSDLRKCCEDGMRDNPMKFPCQRRAQFILQGDACVK
AFLDCCEYITQLRQQHSRDGALELARSDLDDDIIPEEDIISRSQFPESWLWTVIEDLKQA
DKNGISTKLMNVFLKDSITTWEILAVSLSDKKGICVADPYEVTVMQDFFIDLRLPYSVVR
NEQVEIRAILYNYREAENLKVRVELLYNPAFCSLATAKKRHQQTITIPARSSVAVPYVIV
PLKIGLHEVEVKAAVYNHFISDGVKKTLKVVPEGVRVNKTVAVRTLNPEHLGQGGVQREE
VPAADLSDQVPDTESETKILLQGTPVAQMTEDAIDGERLKHLIQTPSGCGEQNMIGMTPT
VIAVHYLDSTDQWEKFGLEKRQESLELIRKGYTQQLAFRQKSSAYAAFQNRPPSTWLTAY
VVKVFALAANLIAIDSKDLCETVKWLILEKQKPDGIFQEDGPVIHQEMIGGFRDTREKDV
SLTAFVLIALHEAKDICEAQVNSLGRSIAKAGDFLENHYRELRRPYTVAIAAYALALLGK
LEGDRLTKFLNTAKEKNRWEEPKQKLYNVEATSYALLALLARKDYDTTPPVVRWLNEQRY
YGGGYGSTQATFMVFQALAQYQKDVPDHKELNLDVSIQLPSRNSAVRHRILWESASLLRS
EETKENERFTVKAEGKGQGTLSVVTVYHAKLKGKVSCKKFDLQVSIRPAPETVKKPQDAK
GSMILDICTKYLGDQDATMSILDISMMTGFSPDVEDLKTLSTGVDRYISKYEMNRDSNKN
TLIIYLDKVSHTVEDCLSFKVHQYFNVGLIQPGAVKVYSYYNLDETCIRFYHPDKEDGML
SKLCHKDTCRCAEENCFMHHTEKEVTLEDRLDKACEPGVDYVYKTRLIQKKLEDDFDEYI
MVIENIIKSGSDEVQVKQERKFISHIKCREALKLKEGAHYLVWGVSSDLWGEKPKISYII
GKDTWVELWPEAEECQDEENQKQCEDLANFTENMVVFGCPN
NT seq 4986 nt   +upstreamnt  +downstreamnt
atgaagcccacctcaggtcccagcctgctgctgctgcttctagccagtctccccatggcc
ctggggaaccccatgtattccatgatcacccccaacatcctgcgtctggagagcgaggag
actgtggtgctggaggcccacggaggacaagggactattcaggtctcggtcaccgtccac
gacttcccggccaagaaacaagtgctgtcaaacgaaaacacccagctgaacagcaacaat
ggctacctgagcaccgtcaccatcaagatcccggccagcaaagagttaaaatccgacaag
gggcacaagttcgtgactgtcgtagcgaccttcgggaatgtccaggtggagaaggtggtg
ctgatcagccttcagagcgggtacctcttcatccagacggacaagaccatctacacccca
ggctccacggtcctctatcgggtcttcactgttgaccacaagctgctgcccgtgggccag
acggttttcatcaccatcgagacccctgatggcatccctgtcaagcgggactccaagtct
tctcagaaccagtttggcattttggccttgtcctggaacattccagagctagtgaacatg
ggggtgtggaagatcaaagcctactatgaagattctccgcagcaggtcttctccgctgag
tttgaggtgaaggaatatgtgcttcccagttttgaggtccaactagagcctgaagagaaa
ttctactacattgatgacccagatggcctgaaggtcaacatcattgccaggttcttgtac
ggggaacaggtggacggaacagctttcgtcatctttggggtccaggatggcgaccggaga
atttcattgactcactccctcacccgtgttccgatcaacgatggtaatggggaggccata
ctgaaacgtcaggttttgctgaatggagtacagccctcccgagctgatgccctggtgggc
aagtccatatatgtgtccgccaccgtcatcttgcaatcaggcagtgacatggtggaggca
gagcgcaccgggatccccattgtgacttccccctaccagatccatttcaccaagaccccc
aagttcttcaaacctgccatgcccttcgacctcatggtgtacgtgacaaaccccgacggc
tcccccgctcgccacatcccggtggtgacccagggcagcaatgtgcagtccttgacccag
gatgatggcgtggccaagctaagcatcaacacacagaacaaacgggatcccctgaccatc
accgtacgcacaaaaaaggacaatatccccgaggggcgacaggccaccaggaccatgcag
gccctaccctacaacacccaggggaactccaataactacctgcacctctctgtgccccgc
gtggagctcaagcctggggagaccctcaacgtcaacttccacctgcgcacggaccccggc
gagcaagccaagatccgctactacacctacatgatcatgaacaaggggaagctgttgaag
gtgggacgccagtaccgagagcccggccaggacctagtggtgttgcccttgaccatcacg
tcagacttcatcccttccttccgcctggtggcctattacacactgattaatgccaaaggc
cagagggaggtggtggccgactctgtgtgggtggatgtcaaggactcgtgtatgggcacg
ctggtggtgaaaaatggtgggaaggaagagaaacaccatcgacccgggcaacagataacc
ctgaagatcgaggctgaccagggggcccgagtggggctcgtggccgtggacaagggcgtg
tttgtgctgaataagaagaacaaattgacccagagaaagatctgggacgtggtggagaaa
gcggacattggctgcaccccaggcagtggaagaaactatgctggtgtcttcacggatgca
ggactcactctcaagaccagccagggcctggagacccagcagagggcagatccgcagtgc
ccgcaaccagccacccgccgacgccgctcggtgcagctcatggagaagaggatggataaa
gcgggtcagtacagcagcgatctgcgcaagtgctgcgaagacggcatgcgggacaacccc
atgaagttcccgtgccagcgccgggcccagttcatcctgcagggcgacgcgtgcgtcaag
gccttcctggactgctgcgagtacatcactcagctgcggcagcagcacagccgcgacggc
gccctggagctggccaggagtgacctggatgatgacataatcccagaggaggacatcatt
tcccgaagccaattccccgagagctggttgtggaccgtcattgaggaccttaaacaagca
gacaaaaatggaatctccacgaagctcatgaacgtgtttttgaaagactccatcaccact
tgggagattctggccgtgagcttgtcagacaagaaagggatctgtgtggctgacccctat
gaggtcactgtgatgcaggatttctttatcgacctgcgtctcccctactcggtggtgcgc
aacgagcaagtggagatccgagcgatcctctacaactaccgggaggcggaaaatctcaag
gtgagggtggaattgctctacaatccagccttctgtagcctggccaccgccaagaagcgc
caccagcagactataacgatcccagccaggtcctcggtggcggtgccttacgtcattgtg
cccctgaagatcggcctccacgaggtggaggtcaaggctgccgtctacaaccacttcatc
agtgatggtgtcaagaagaccctgaaggtcgtgccagaaggcgtaagagtcaacaaaact
gtggctgttcgtacactgaatccagaacatctgggtcaagggggagtgcagcgagaggaa
gtcccagctgcagatcttagtgatcaagtcccagacaccgagtcagagactaagatcctc
ctgcaagggactccggtggcccaaatgacggaggacgccatcgacggagagcggctgaag
caccttatccaaaccccctccggctgtggggagcagaacatgattggtatgacgcccacg
gtcatcgccgtgcactacctggacagcaccgaccagtgggagaagttcggcttggagaag
cggcaggagtccctggagctcatcagaaaggggtacacccagcagctggccttcagacaa
aaaagctcagcctacgccgccttccagaatcggccccccagcacctggctgacagcctac
gtggtcaaggtctttgcactggccgccaacctcatcgccatagactccaaggacctctgt
gagacggtcaaatggctgatcctggagaagcagaagcctgatggaatcttccaggaggat
gggcctgtgatacaccaagaaatgattggtggcttcagggacaccagggagaaagatgtg
tcccttacagcctttgttctcatcgcgctgcacgaggctaaagacatttgcgaggcacag
gtcaacagcctgggccgcagcatcgctaaggcaggagacttccttgaaaaccactacaga
gagttgcgaagaccatatactgtggccattgctgcctatgccctggctttgttgggcaag
ctggagggtgaccgcctcaccaaatttctgaacacagccaaagaaaagaaccgctgggag
gaacccaaacagaagctctacaatgtggaggccacgtcctacgccctcttggctctgctg
gcacgcaaagactacgacactacgcctcctgtcgtgcgctggctcaacgagcagagatac
tatggaggtggttatggctccacgcaggccactttcatggtgttccaagccttggcccaa
taccagaaggatgttcctgatcacaaggagctgaacctggatgtgtccatccaactgccc
agccgcaactctgcggtcaggcatcgtatcctctgggaatctgccagcctcctgcgctca
gaagagactaaggaaaatgagcgtttcacagtaaaagctgaagggaaaggacaaggcacc
ttgtcggtagtgaccgtgtaccatgccaagctcaaaggcaaagtctcctgcaaaaagttc
gacctccaggtttccatacgcccagcccccgaaacagtcaagaagcctcaggacgccaaa
ggttccatgatccttgacatctgtaccaagtacctgggagaccaggatgccactatgtcc
atcctggatatatctatgatgacaggcttctcacctgatgttgaagacctcaaaacgctg
agcactggtgtcgacagatacatctctaagtatgagatgaacagagactccaacaagaac
acactcatcatctacctggacaaggtctcacacacagtggaggactgtctgtccttcaaa
gttcaccagtactttaatgtcggacttatacagcctggggcagtcaaggtgtactcctat
tacaacctggatgaaacttgtatccgcttctaccacccggataaagaggacggaatgctg
agcaaactctgccacaaagatacctgccgctgtgcagaggagaactgcttcatgcaccac
acggagaaggaggtcactctggaggaccggctggacaaggcttgcgagccgggcgtggac
tatgtgtacaagaccagacttatccagaagaagctggaagatgactttgacgagtacatc
atggtgatcgagaacatcatcaaatcgggctccgacgaggtgcaggttaaacaggagcgc
aagttcatcagccacatcaagtgcagggaagcccttaaactgaaggagggggcacactat
ctcgtgtggggcgtgtcctctgacctgtggggcgagaaacccaagatcagctacatcatc
gggaaggacacctgggtggagctgtggcccgaggctgaagaatgtcaagatgaggagaac
cagaaacagtgcgaggacctggccaacttcacagagaacatggtcgtctttggctgcccc
aactga

DBGET integrated database retrieval system