Bos mutus (wild yak): 102271030 Help Entry 102271030         CDS       T02919                                  Gene name MAPK13 Definition (RefSeq) mitogen-activated protein kinase 13   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism bom  Bos mutus (wild yak) Pathway bom01522   Endocrine resistance bom04010   MAPK signaling pathway bom04015   Rap1 signaling pathway bom04068   FoxO signaling pathway bom04071   Sphingolipid signaling pathway bom04114   Oocyte meiosis bom04218   Cellular senescence bom04261   Adrenergic signaling in cardiomyocytes bom04370   VEGF signaling pathway bom04380   Osteoclast differentiation bom04550   Signaling pathways regulating pluripotency of stem cells bom04611   Platelet activation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04625   C-type lectin receptor signaling pathway bom04657   IL-17 signaling pathway bom04658   Th1 and Th2 cell differentiation bom04659   Th17 cell differentiation bom04660   T cell receptor signaling pathway bom04664   Fc epsilon RI signaling pathway bom04668   TNF signaling pathway bom04670   Leukocyte transendothelial migration bom04714   Thermogenesis bom04722   Neurotrophin signaling pathway bom04723   Retrograde endocannabinoid signaling bom04728   Dopaminergic synapse bom04750   Inflammatory mediator regulation of TRP channels bom04912   GnRH signaling pathway bom04914   Progesterone-mediated oocyte maturation bom04917   Prolactin signaling pathway bom04926   Relaxin signaling pathway bom04933   AGE-RAGE signaling pathway in diabetic complications bom04935   Growth hormone synthesis, secretion and action bom05014   Amyotrophic lateral sclerosis bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05132   Salmonella infection bom05133   Pertussis bom05135   Yersinia infection bom05140   Leishmaniasis bom05142   Chagas disease bom05145   Toxoplasmosis bom05152   Tuberculosis bom05161   Hepatitis B bom05163   Human cytomegalovirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05205   Proteoglycans in cancer bom05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102271030 (MAPK13)    04015 Rap1 signaling pathway     102271030 (MAPK13)    04370 VEGF signaling pathway     102271030 (MAPK13)    04668 TNF signaling pathway     102271030 (MAPK13)    04068 FoxO signaling pathway     102271030 (MAPK13)    04071 Sphingolipid signaling pathway     102271030 (MAPK13)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102271030 (MAPK13)    04218 Cellular senescence     102271030 (MAPK13)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102271030 (MAPK13)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102271030 (MAPK13)    04620 Toll-like receptor signaling pathway     102271030 (MAPK13)    04621 NOD-like receptor signaling pathway     102271030 (MAPK13)    04622 RIG-I-like receptor signaling pathway     102271030 (MAPK13)    04625 C-type lectin receptor signaling pathway     102271030 (MAPK13)    04660 T cell receptor signaling pathway     102271030 (MAPK13)    04658 Th1 and Th2 cell differentiation     102271030 (MAPK13)    04659 Th17 cell differentiation     102271030 (MAPK13)    04657 IL-17 signaling pathway     102271030 (MAPK13)    04664 Fc epsilon RI signaling pathway     102271030 (MAPK13)    04670 Leukocyte transendothelial migration     102271030 (MAPK13)   09152 Endocrine system    04912 GnRH signaling pathway     102271030 (MAPK13)    04914 Progesterone-mediated oocyte maturation     102271030 (MAPK13)    04917 Prolactin signaling pathway     102271030 (MAPK13)    04926 Relaxin signaling pathway     102271030 (MAPK13)    04935 Growth hormone synthesis, secretion and action     102271030 (MAPK13)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102271030 (MAPK13)   09156 Nervous system    04728 Dopaminergic synapse     102271030 (MAPK13)    04723 Retrograde endocannabinoid signaling     102271030 (MAPK13)    04722 Neurotrophin signaling pathway     102271030 (MAPK13)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102271030 (MAPK13)   09158 Development and regeneration    04380 Osteoclast differentiation     102271030 (MAPK13)   09159 Environmental adaptation    04714 Thermogenesis     102271030 (MAPK13)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102271030 (MAPK13)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102271030 (MAPK13)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102271030 (MAPK13)    05020 Prion disease     102271030 (MAPK13)    05022 Pathways of neurodegeneration - multiple diseases     102271030 (MAPK13)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102271030 (MAPK13)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102271030 (MAPK13)   09171 Infectious disease: bacterial    05132 Salmonella infection     102271030 (MAPK13)    05135 Yersinia infection     102271030 (MAPK13)    05133 Pertussis     102271030 (MAPK13)    05152 Tuberculosis     102271030 (MAPK13)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102271030 (MAPK13)    05161 Hepatitis B     102271030 (MAPK13)    05171 Coronavirus disease - COVID-19     102271030 (MAPK13)    05163 Human cytomegalovirus infection     102271030 (MAPK13)    05167 Kaposi sarcoma-associated herpesvirus infection     102271030 (MAPK13)    05169 Epstein-Barr virus infection     102271030 (MAPK13)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102271030 (MAPK13)    05140 Leishmaniasis     102271030 (MAPK13)    05142 Chagas disease     102271030 (MAPK13)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102271030 (MAPK13) Enzymes [BR:bom01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102271030 (MAPK13) Protein kinases [BR:bom01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102271030 (MAPK13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr RIO1 APH Kinase-like Kdo DUF4023 Motif Other DBs NCBI-GeneID:  102271030 NCBI-ProteinID:  XP_005890567 UniProt:  L8IW17 LinkDB All DBs Position Un AA seq 366 aa AA seqDB search MSFTRKKGFYKQDVNKTAWELPKTYVSLTHIGSGAYGSVCSAIDKRSGEKVAIKKLSRPF QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHTDVEMT GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG VPGAEFVQKLNDKAAKSYIQSLPQSPKKDFSQLFPRASPQATDLLEKMLELDVDKRLTAS QALAHPFFEPFRDPEEETEAQQPLEDSLEREKLTVDEWKQHIYKEIVNFSPIARKDSRRR SGMKLQ NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt atgagcttcacccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag ctgcccaagacctacgtgtccctgacgcacataggcagcggggcctacggctcagtgtgc tcagccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc cagtccgagatctttgccaagcgggcttatcgggagctgctgctgctgaaacacatgcag catgagaacgtcatcgggcttctggatgtcttcaccccagcctcctccctgcgcaacttc catgacttctacctggtgatgcccttcatgcagacggacctgcagaagatcatggggatg gagttcagtgaggacaagatccagtacctggtgtaccagatgctcaagggtcttaagtac atccactcagctggggtcgtccacagggacctgaagccgggcaacctcgctgtgaatgag gactgtgagctgaagatcttggattttgggttggcacggcatacggatgtggagatgacg ggttacgtggtgacccgctggtaccgggcccctgaggtgattctcagctggatgcattac aatcagactgtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaag acactgttcaaggggaaagactacctggaccagctgacccagattctgaaagtgaccggg gtgccgggtgcagagtttgtgcagaagctcaatgacaaggcggccaaatcctacatccag tccctgccacaaagccccaaaaaggatttctctcagctcttcccgcgtgccagcccccag gccacagacctgctggagaagatgctggagctggacgtggacaagcgcctgacggcctcg caggccctcgcccaccccttctttgagcccttccgggaccctgaggaggagacagaggcc cagcagccgctcgaggattccttagaacgcgagaaactcacagtggacgagtggaagcag cacatctacaaggagatcgtgaacttcagccccattgcccggaaggactctcggcgccgg agtggcatgaagctgcagtga

Bos mutus (wild yak): 102271320 Help Entry 102271320         CDS       T02919                                  Gene name MAPK14 Definition (RefSeq) mitogen-activated protein kinase 14   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism bom  Bos mutus (wild yak) Pathway bom01522   Endocrine resistance bom04010   MAPK signaling pathway bom04015   Rap1 signaling pathway bom04068   FoxO signaling pathway bom04071   Sphingolipid signaling pathway bom04114   Oocyte meiosis bom04218   Cellular senescence bom04261   Adrenergic signaling in cardiomyocytes bom04370   VEGF signaling pathway bom04380   Osteoclast differentiation bom04550   Signaling pathways regulating pluripotency of stem cells bom04611   Platelet activation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04625   C-type lectin receptor signaling pathway bom04657   IL-17 signaling pathway bom04658   Th1 and Th2 cell differentiation bom04659   Th17 cell differentiation bom04660   T cell receptor signaling pathway bom04664   Fc epsilon RI signaling pathway bom04668   TNF signaling pathway bom04670   Leukocyte transendothelial migration bom04714   Thermogenesis bom04722   Neurotrophin signaling pathway bom04723   Retrograde endocannabinoid signaling bom04728   Dopaminergic synapse bom04750   Inflammatory mediator regulation of TRP channels bom04912   GnRH signaling pathway bom04914   Progesterone-mediated oocyte maturation bom04917   Prolactin signaling pathway bom04926   Relaxin signaling pathway bom04933   AGE-RAGE signaling pathway in diabetic complications bom04935   Growth hormone synthesis, secretion and action bom05014   Amyotrophic lateral sclerosis bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05132   Salmonella infection bom05133   Pertussis bom05135   Yersinia infection bom05140   Leishmaniasis bom05142   Chagas disease bom05145   Toxoplasmosis bom05152   Tuberculosis bom05161   Hepatitis B bom05163   Human cytomegalovirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05205   Proteoglycans in cancer bom05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102271320 (MAPK14)    04015 Rap1 signaling pathway     102271320 (MAPK14)    04370 VEGF signaling pathway     102271320 (MAPK14)    04668 TNF signaling pathway     102271320 (MAPK14)    04068 FoxO signaling pathway     102271320 (MAPK14)    04071 Sphingolipid signaling pathway     102271320 (MAPK14)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102271320 (MAPK14)    04218 Cellular senescence     102271320 (MAPK14)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102271320 (MAPK14)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102271320 (MAPK14)    04620 Toll-like receptor signaling pathway     102271320 (MAPK14)    04621 NOD-like receptor signaling pathway     102271320 (MAPK14)    04622 RIG-I-like receptor signaling pathway     102271320 (MAPK14)    04625 C-type lectin receptor signaling pathway     102271320 (MAPK14)    04660 T cell receptor signaling pathway     102271320 (MAPK14)    04658 Th1 and Th2 cell differentiation     102271320 (MAPK14)    04659 Th17 cell differentiation     102271320 (MAPK14)    04657 IL-17 signaling pathway     102271320 (MAPK14)    04664 Fc epsilon RI signaling pathway     102271320 (MAPK14)    04670 Leukocyte transendothelial migration     102271320 (MAPK14)   09152 Endocrine system    04912 GnRH signaling pathway     102271320 (MAPK14)    04914 Progesterone-mediated oocyte maturation     102271320 (MAPK14)    04917 Prolactin signaling pathway     102271320 (MAPK14)    04926 Relaxin signaling pathway     102271320 (MAPK14)    04935 Growth hormone synthesis, secretion and action     102271320 (MAPK14)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102271320 (MAPK14)   09156 Nervous system    04728 Dopaminergic synapse     102271320 (MAPK14)    04723 Retrograde endocannabinoid signaling     102271320 (MAPK14)    04722 Neurotrophin signaling pathway     102271320 (MAPK14)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102271320 (MAPK14)   09158 Development and regeneration    04380 Osteoclast differentiation     102271320 (MAPK14)   09159 Environmental adaptation    04714 Thermogenesis     102271320 (MAPK14)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102271320 (MAPK14)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102271320 (MAPK14)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102271320 (MAPK14)    05020 Prion disease     102271320 (MAPK14)    05022 Pathways of neurodegeneration - multiple diseases     102271320 (MAPK14)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102271320 (MAPK14)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102271320 (MAPK14)   09171 Infectious disease: bacterial    05132 Salmonella infection     102271320 (MAPK14)    05135 Yersinia infection     102271320 (MAPK14)    05133 Pertussis     102271320 (MAPK14)    05152 Tuberculosis     102271320 (MAPK14)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102271320 (MAPK14)    05161 Hepatitis B     102271320 (MAPK14)    05171 Coronavirus disease - COVID-19     102271320 (MAPK14)    05163 Human cytomegalovirus infection     102271320 (MAPK14)    05167 Kaposi sarcoma-associated herpesvirus infection     102271320 (MAPK14)    05169 Epstein-Barr virus infection     102271320 (MAPK14)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102271320 (MAPK14)    05140 Leishmaniasis     102271320 (MAPK14)    05142 Chagas disease     102271320 (MAPK14)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102271320 (MAPK14) Enzymes [BR:bom01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102271320 (MAPK14) Protein kinases [BR:bom01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102271320 (MAPK14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like Motif Other DBs NCBI-GeneID:  102271320 NCBI-ProteinID:  XP_005890568 LinkDB All DBs Position Un AA seq 360 aa AA seqDB search MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atgtctcaggagaggcccacgttctaccggcaggagctgaacaagaccatctgggaggtg cccgagcgttaccagaacctgtccccggtgggctccggcgcctatggctccgtgtgtgct gcttttgacacaaaaactgggttacgtgtcgcagtgaagaagctatccagaccatttcag tccattattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaagcat gaaaatgtaattggtctgttggatgttttcacacctgcaaggtctctggaggaattcaat gatgtgtacctggtgacccatctcatgggggcagatctgaacaacatcgtgaaatgtcag aagcttacagatgaccatgttcagttccttatctaccagattctcagaggtctcaagtat atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa gactgtgagctgaagatcttggatttcggactggctcgacatacagatgatgaaatgaca ggctatgtggccaccaggtggtacagggctcctgagatcatgctgaactggatgcattac aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacattcag tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccttg gctgtcgacctgctggagaagatgcttgtattggactcagataagagaatcacagcagca caagcccttgcacatgcctacttcgcccagtaccacgatcctgacgacgaaccagtggct gatccttacgatcagtcttttgaaagcagggacctccttatagacgaatggaaaagcctg acctatgatgaagtcatcagctttgtgccgccaccccttgaccaagaagagatggagtct tga

Bos mutus (wild yak): 102285848 Help Entry 102285848         CDS       T02919                                  Gene name MAPK12 Definition (RefSeq) mitogen-activated protein kinase 12   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism bom  Bos mutus (wild yak) Pathway bom01522   Endocrine resistance bom04010   MAPK signaling pathway bom04015   Rap1 signaling pathway bom04068   FoxO signaling pathway bom04071   Sphingolipid signaling pathway bom04114   Oocyte meiosis bom04218   Cellular senescence bom04261   Adrenergic signaling in cardiomyocytes bom04370   VEGF signaling pathway bom04380   Osteoclast differentiation bom04550   Signaling pathways regulating pluripotency of stem cells bom04611   Platelet activation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04625   C-type lectin receptor signaling pathway bom04657   IL-17 signaling pathway bom04658   Th1 and Th2 cell differentiation bom04659   Th17 cell differentiation bom04660   T cell receptor signaling pathway bom04664   Fc epsilon RI signaling pathway bom04668   TNF signaling pathway bom04670   Leukocyte transendothelial migration bom04714   Thermogenesis bom04722   Neurotrophin signaling pathway bom04723   Retrograde endocannabinoid signaling bom04728   Dopaminergic synapse bom04750   Inflammatory mediator regulation of TRP channels bom04912   GnRH signaling pathway bom04914   Progesterone-mediated oocyte maturation bom04917   Prolactin signaling pathway bom04926   Relaxin signaling pathway bom04933   AGE-RAGE signaling pathway in diabetic complications bom04935   Growth hormone synthesis, secretion and action bom05014   Amyotrophic lateral sclerosis bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05132   Salmonella infection bom05133   Pertussis bom05135   Yersinia infection bom05140   Leishmaniasis bom05142   Chagas disease bom05145   Toxoplasmosis bom05152   Tuberculosis bom05161   Hepatitis B bom05163   Human cytomegalovirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05205   Proteoglycans in cancer bom05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102285848 (MAPK12)    04015 Rap1 signaling pathway     102285848 (MAPK12)    04370 VEGF signaling pathway     102285848 (MAPK12)    04668 TNF signaling pathway     102285848 (MAPK12)    04068 FoxO signaling pathway     102285848 (MAPK12)    04071 Sphingolipid signaling pathway     102285848 (MAPK12)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102285848 (MAPK12)    04218 Cellular senescence     102285848 (MAPK12)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102285848 (MAPK12)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102285848 (MAPK12)    04620 Toll-like receptor signaling pathway     102285848 (MAPK12)    04621 NOD-like receptor signaling pathway     102285848 (MAPK12)    04622 RIG-I-like receptor signaling pathway     102285848 (MAPK12)    04625 C-type lectin receptor signaling pathway     102285848 (MAPK12)    04660 T cell receptor signaling pathway     102285848 (MAPK12)    04658 Th1 and Th2 cell differentiation     102285848 (MAPK12)    04659 Th17 cell differentiation     102285848 (MAPK12)    04657 IL-17 signaling pathway     102285848 (MAPK12)    04664 Fc epsilon RI signaling pathway     102285848 (MAPK12)    04670 Leukocyte transendothelial migration     102285848 (MAPK12)   09152 Endocrine system    04912 GnRH signaling pathway     102285848 (MAPK12)    04914 Progesterone-mediated oocyte maturation     102285848 (MAPK12)    04917 Prolactin signaling pathway     102285848 (MAPK12)    04926 Relaxin signaling pathway     102285848 (MAPK12)    04935 Growth hormone synthesis, secretion and action     102285848 (MAPK12)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102285848 (MAPK12)   09156 Nervous system    04728 Dopaminergic synapse     102285848 (MAPK12)    04723 Retrograde endocannabinoid signaling     102285848 (MAPK12)    04722 Neurotrophin signaling pathway     102285848 (MAPK12)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102285848 (MAPK12)   09158 Development and regeneration    04380 Osteoclast differentiation     102285848 (MAPK12)   09159 Environmental adaptation    04714 Thermogenesis     102285848 (MAPK12)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102285848 (MAPK12)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102285848 (MAPK12)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102285848 (MAPK12)    05020 Prion disease     102285848 (MAPK12)    05022 Pathways of neurodegeneration - multiple diseases     102285848 (MAPK12)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102285848 (MAPK12)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102285848 (MAPK12)   09171 Infectious disease: bacterial    05132 Salmonella infection     102285848 (MAPK12)    05135 Yersinia infection     102285848 (MAPK12)    05133 Pertussis     102285848 (MAPK12)    05152 Tuberculosis     102285848 (MAPK12)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102285848 (MAPK12)    05161 Hepatitis B     102285848 (MAPK12)    05171 Coronavirus disease - COVID-19     102285848 (MAPK12)    05163 Human cytomegalovirus infection     102285848 (MAPK12)    05167 Kaposi sarcoma-associated herpesvirus infection     102285848 (MAPK12)    05169 Epstein-Barr virus infection     102285848 (MAPK12)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102285848 (MAPK12)    05140 Leishmaniasis     102285848 (MAPK12)    05142 Chagas disease     102285848 (MAPK12)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102285848 (MAPK12) Enzymes [BR:bom01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102285848 (MAPK12) Protein kinases [BR:bom01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102285848 (MAPK12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like UvrD_C Motif Other DBs NCBI-GeneID:  102285848 NCBI-ProteinID:  XP_005903977 LinkDB All DBs Position Un AA seq 346 aa AA seqDB search MPVWVAFWPVTEAGPHARPCSSAYDTRLRQRVAVKKLSRPFQSLIHARRTYRELRLLKHL KHENVIGLLDVFTPDETLDDFMDFYLVMPFMGTDLGKLMKHEKLSEDRVQFLVYQTLKGL KYIHAAGVIHRDLKPSNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWM HYTQTVDIWSVGCIMAEMITGKTLFKGNDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNY MKGLPELEKKDFASVLTNASPLAVSLLEKMLVLDAERRVTAAEALAHPYFESLHDTEDDP QAEKYDESFDDMDRTLDEWKRVTYKEVLSFKPPRQLGAKVSKETAL NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt atgcccgtgtgggtggccttctggccagtcaccgaggcggggcctcacgcgcggccttgc agctcggcctacgacacgcggctgcgccagagggtggcggtgaagaagctgtcgcggccc ttccagtctctgatccatgcgcggaggacctaccgggagctgcggctgctcaaacacctg aagcacgagaacgtgattgggctgctggacgtgttcacgcccgatgagacgctggatgac ttcatggacttctacctggtgatgccgttcatgggcaccgacctgggaaagctcatgaag cacgagaagctgagcgaggaccgggtgcagttcctcgtctaccagacgctcaaggggctg aagtacatccacgctgccggcgtcatccacagggacctgaagcctagcaacctggctgtg aacgaggactgtgagctgaagatcctggactttggcctggcccggcaggcagacagcgag atgaccggctacgtggtgacccggtggtaccgcgcgcccgaggtcatcttgaactggatg cactacacgcagacggtggacatctggtccgtgggctgcatcatggccgagatgatcacg gggaagacactcttcaaaggcaacgaccacctggaccagctgaaggagatcatgaaggtg acggggacgcctcccgcggagtttgtgcagaggctgcaaagtgatgaggccaagaactac atgaagggcctccctgagctggagaagaaggattttgcctccgtcctgaccaacgcgagc cccctggccgtgagcctcctggagaaaatgctggtgctggatgcggagcggcgggtgacg gcggccgaggcgctggcccacccctactttgagtcgctgcacgacacggaggacgatccc caggccgagaagtacgatgagtcctttgacgacatggaccgcacgctggacgagtggaag cgtgtcacatataaagaggtgctcagcttcaagcctccccggcagctgggggccaaggtc tccaaggagacagccttgtga

Bos mutus (wild yak): 106701244 Help Entry 106701244         CDS       T02919                                  Gene name MAPK11 Definition (RefSeq) mitogen-activated protein kinase 11   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism bom  Bos mutus (wild yak) Pathway bom01522   Endocrine resistance bom04010   MAPK signaling pathway bom04015   Rap1 signaling pathway bom04068   FoxO signaling pathway bom04071   Sphingolipid signaling pathway bom04114   Oocyte meiosis bom04218   Cellular senescence bom04261   Adrenergic signaling in cardiomyocytes bom04370   VEGF signaling pathway bom04380   Osteoclast differentiation bom04550   Signaling pathways regulating pluripotency of stem cells bom04611   Platelet activation bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04625   C-type lectin receptor signaling pathway bom04657   IL-17 signaling pathway bom04658   Th1 and Th2 cell differentiation bom04659   Th17 cell differentiation bom04660   T cell receptor signaling pathway bom04664   Fc epsilon RI signaling pathway bom04668   TNF signaling pathway bom04670   Leukocyte transendothelial migration bom04714   Thermogenesis bom04722   Neurotrophin signaling pathway bom04723   Retrograde endocannabinoid signaling bom04728   Dopaminergic synapse bom04750   Inflammatory mediator regulation of TRP channels bom04912   GnRH signaling pathway bom04914   Progesterone-mediated oocyte maturation bom04917   Prolactin signaling pathway bom04926   Relaxin signaling pathway bom04933   AGE-RAGE signaling pathway in diabetic complications bom04935   Growth hormone synthesis, secretion and action bom05014   Amyotrophic lateral sclerosis bom05020   Prion disease bom05022   Pathways of neurodegeneration - multiple diseases bom05132   Salmonella infection bom05133   Pertussis bom05135   Yersinia infection bom05140   Leishmaniasis bom05142   Chagas disease bom05145   Toxoplasmosis bom05152   Tuberculosis bom05161   Hepatitis B bom05163   Human cytomegalovirus infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05169   Epstein-Barr virus infection bom05170   Human immunodeficiency virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05205   Proteoglycans in cancer bom05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106701244 (MAPK11)    04015 Rap1 signaling pathway     106701244 (MAPK11)    04370 VEGF signaling pathway     106701244 (MAPK11)    04668 TNF signaling pathway     106701244 (MAPK11)    04068 FoxO signaling pathway     106701244 (MAPK11)    04071 Sphingolipid signaling pathway     106701244 (MAPK11)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     106701244 (MAPK11)    04218 Cellular senescence     106701244 (MAPK11)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     106701244 (MAPK11)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     106701244 (MAPK11)    04620 Toll-like receptor signaling pathway     106701244 (MAPK11)    04621 NOD-like receptor signaling pathway     106701244 (MAPK11)    04622 RIG-I-like receptor signaling pathway     106701244 (MAPK11)    04625 C-type lectin receptor signaling pathway     106701244 (MAPK11)    04660 T cell receptor signaling pathway     106701244 (MAPK11)    04658 Th1 and Th2 cell differentiation     106701244 (MAPK11)    04659 Th17 cell differentiation     106701244 (MAPK11)    04657 IL-17 signaling pathway     106701244 (MAPK11)    04664 Fc epsilon RI signaling pathway     106701244 (MAPK11)    04670 Leukocyte transendothelial migration     106701244 (MAPK11)   09152 Endocrine system    04912 GnRH signaling pathway     106701244 (MAPK11)    04914 Progesterone-mediated oocyte maturation     106701244 (MAPK11)    04917 Prolactin signaling pathway     106701244 (MAPK11)    04926 Relaxin signaling pathway     106701244 (MAPK11)    04935 Growth hormone synthesis, secretion and action     106701244 (MAPK11)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     106701244 (MAPK11)   09156 Nervous system    04728 Dopaminergic synapse     106701244 (MAPK11)    04723 Retrograde endocannabinoid signaling     106701244 (MAPK11)    04722 Neurotrophin signaling pathway     106701244 (MAPK11)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     106701244 (MAPK11)   09158 Development and regeneration    04380 Osteoclast differentiation     106701244 (MAPK11)   09159 Environmental adaptation    04714 Thermogenesis     106701244 (MAPK11)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     106701244 (MAPK11)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     106701244 (MAPK11)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106701244 (MAPK11)    05020 Prion disease     106701244 (MAPK11)    05022 Pathways of neurodegeneration - multiple diseases     106701244 (MAPK11)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106701244 (MAPK11)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     106701244 (MAPK11)   09171 Infectious disease: bacterial    05132 Salmonella infection     106701244 (MAPK11)    05135 Yersinia infection     106701244 (MAPK11)    05133 Pertussis     106701244 (MAPK11)    05152 Tuberculosis     106701244 (MAPK11)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     106701244 (MAPK11)    05161 Hepatitis B     106701244 (MAPK11)    05171 Coronavirus disease - COVID-19     106701244 (MAPK11)    05163 Human cytomegalovirus infection     106701244 (MAPK11)    05167 Kaposi sarcoma-associated herpesvirus infection     106701244 (MAPK11)    05169 Epstein-Barr virus infection     106701244 (MAPK11)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     106701244 (MAPK11)    05140 Leishmaniasis     106701244 (MAPK11)    05142 Chagas disease     106701244 (MAPK11)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     106701244 (MAPK11) Enzymes [BR:bom01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      106701244 (MAPK11) Protein kinases [BR:bom01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    106701244 (MAPK11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Cas_CT1975 Motif Other DBs NCBI-GeneID:  106701244 NCBI-ProteinID:  XP_014336342 LinkDB All DBs Position Un AA seq 246 aa AA seqDB search MGADLNNIVKCQALSDEHVQFLVYQLLRGLKDLKPSNVAVNEDCELRILDFGLARQADEE MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEV VGTPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFRGANPLAVDLLGRMLVLDSDQRVS AAEALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPPEPPQPLG SLDVEQ NT seq 741 nt NT seq  +upstreamnt  +downstreamnt atgggcgccgacctgaacaacatcgtcaagtgccaggcgctgagtgacgagcacgtccag ttcctcgtgtaccagctgctgcgcgggctaaaggacctgaagcccagcaacgtggccgtg aacgaggactgcgagctgcggatcctggacttcgggctagcgcgccaggcagacgaggag atgactggctacgtggccacacgatggtacagggcccccgagatcatgctgaactggatg cactacaaccagacagtggacatttggtccgtgggctgcatcatggctgagctgctccag ggaaaggctctcttccccggaagtgactacatcgaccagctgaagcgtatcatggaggtg gtgggcacacccagtcctgaggttctagcaaagatatcctcggaacatgcccggacctac atccagtccctgccccccatgccccagaaggacctcaggagcatcttccgcggagccaac cccctggctgtggacctcctgggcaggatgctggtgctggacagtgaccagagggtcagc gcggcagaggccctggcacacgcctacttcagccagtaccacgacccggacgacgagccc gaggcggagccttacgacgagagcgtggaggccaaggagcgcacggtggaggagtggaag gagctcacgtaccaggaagtcctcagcttcaagcccccagagcccccgcagccgctgggc agcctggacgttgagcagtga

DBGET integrated database retrieval system