KEGG   Bos mutus (wild yak): 102271030
Entry
102271030         CDS       T02919                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04015  Rap1 signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04114  Oocyte meiosis
bom04218  Cellular senescence
bom04261  Adrenergic signaling in cardiomyocytes
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04714  Thermogenesis
bom04722  Neurotrophin signaling pathway
bom04723  Retrograde endocannabinoid signaling
bom04728  Dopaminergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04912  GnRH signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04917  Prolactin signaling pathway
bom04926  Relaxin signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05133  Pertussis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05205  Proteoglycans in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102271030 (MAPK13)
   04015 Rap1 signaling pathway
    102271030 (MAPK13)
   04370 VEGF signaling pathway
    102271030 (MAPK13)
   04668 TNF signaling pathway
    102271030 (MAPK13)
   04068 FoxO signaling pathway
    102271030 (MAPK13)
   04071 Sphingolipid signaling pathway
    102271030 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102271030 (MAPK13)
   04218 Cellular senescence
    102271030 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102271030 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102271030 (MAPK13)
   04620 Toll-like receptor signaling pathway
    102271030 (MAPK13)
   04621 NOD-like receptor signaling pathway
    102271030 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    102271030 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    102271030 (MAPK13)
   04660 T cell receptor signaling pathway
    102271030 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    102271030 (MAPK13)
   04659 Th17 cell differentiation
    102271030 (MAPK13)
   04657 IL-17 signaling pathway
    102271030 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    102271030 (MAPK13)
   04670 Leukocyte transendothelial migration
    102271030 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102271030 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    102271030 (MAPK13)
   04917 Prolactin signaling pathway
    102271030 (MAPK13)
   04926 Relaxin signaling pathway
    102271030 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    102271030 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102271030 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    102271030 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    102271030 (MAPK13)
   04722 Neurotrophin signaling pathway
    102271030 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102271030 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102271030 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    102271030 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102271030 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102271030 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102271030 (MAPK13)
   05020 Prion disease
    102271030 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    102271030 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102271030 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102271030 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102271030 (MAPK13)
   05135 Yersinia infection
    102271030 (MAPK13)
   05133 Pertussis
    102271030 (MAPK13)
   05152 Tuberculosis
    102271030 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102271030 (MAPK13)
   05161 Hepatitis B
    102271030 (MAPK13)
   05171 Coronavirus disease - COVID-19
    102271030 (MAPK13)
   05163 Human cytomegalovirus infection
    102271030 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102271030 (MAPK13)
   05169 Epstein-Barr virus infection
    102271030 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102271030 (MAPK13)
   05140 Leishmaniasis
    102271030 (MAPK13)
   05142 Chagas disease
    102271030 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102271030 (MAPK13)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102271030 (MAPK13)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102271030 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 APH Kinase-like Kdo DUF4023
Other DBs
NCBI-GeneID: 102271030
NCBI-ProteinID: XP_005890567
UniProt: L8IW17
LinkDB
Position
Un
AA seq 366 aa
MSFTRKKGFYKQDVNKTAWELPKTYVSLTHIGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHTDVEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLNDKAAKSYIQSLPQSPKKDFSQLFPRASPQATDLLEKMLELDVDKRLTAS
QALAHPFFEPFRDPEEETEAQQPLEDSLEREKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcttcacccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccctgacgcacataggcagcggggcctacggctcagtgtgc
tcagccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatctttgccaagcgggcttatcgggagctgctgctgctgaaacacatgcag
catgagaacgtcatcgggcttctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggacctgcagaagatcatggggatg
gagttcagtgaggacaagatccagtacctggtgtaccagatgctcaagggtcttaagtac
atccactcagctggggtcgtccacagggacctgaagccgggcaacctcgctgtgaatgag
gactgtgagctgaagatcttggattttgggttggcacggcatacggatgtggagatgacg
ggttacgtggtgacccgctggtaccgggcccctgaggtgattctcagctggatgcattac
aatcagactgtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaag
acactgttcaaggggaaagactacctggaccagctgacccagattctgaaagtgaccggg
gtgccgggtgcagagtttgtgcagaagctcaatgacaaggcggccaaatcctacatccag
tccctgccacaaagccccaaaaaggatttctctcagctcttcccgcgtgccagcccccag
gccacagacctgctggagaagatgctggagctggacgtggacaagcgcctgacggcctcg
caggccctcgcccaccccttctttgagcccttccgggaccctgaggaggagacagaggcc
cagcagccgctcgaggattccttagaacgcgagaaactcacagtggacgagtggaagcag
cacatctacaaggagatcgtgaacttcagccccattgcccggaaggactctcggcgccgg
agtggcatgaagctgcagtga

KEGG   Bos mutus (wild yak): 102271320
Entry
102271320         CDS       T02919                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04015  Rap1 signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04114  Oocyte meiosis
bom04218  Cellular senescence
bom04261  Adrenergic signaling in cardiomyocytes
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04714  Thermogenesis
bom04722  Neurotrophin signaling pathway
bom04723  Retrograde endocannabinoid signaling
bom04728  Dopaminergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04912  GnRH signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04917  Prolactin signaling pathway
bom04926  Relaxin signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05133  Pertussis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05205  Proteoglycans in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102271320 (MAPK14)
   04015 Rap1 signaling pathway
    102271320 (MAPK14)
   04370 VEGF signaling pathway
    102271320 (MAPK14)
   04668 TNF signaling pathway
    102271320 (MAPK14)
   04068 FoxO signaling pathway
    102271320 (MAPK14)
   04071 Sphingolipid signaling pathway
    102271320 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102271320 (MAPK14)
   04218 Cellular senescence
    102271320 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102271320 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102271320 (MAPK14)
   04620 Toll-like receptor signaling pathway
    102271320 (MAPK14)
   04621 NOD-like receptor signaling pathway
    102271320 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    102271320 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    102271320 (MAPK14)
   04660 T cell receptor signaling pathway
    102271320 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    102271320 (MAPK14)
   04659 Th17 cell differentiation
    102271320 (MAPK14)
   04657 IL-17 signaling pathway
    102271320 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    102271320 (MAPK14)
   04670 Leukocyte transendothelial migration
    102271320 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102271320 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    102271320 (MAPK14)
   04917 Prolactin signaling pathway
    102271320 (MAPK14)
   04926 Relaxin signaling pathway
    102271320 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    102271320 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102271320 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    102271320 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    102271320 (MAPK14)
   04722 Neurotrophin signaling pathway
    102271320 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102271320 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102271320 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    102271320 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102271320 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102271320 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102271320 (MAPK14)
   05020 Prion disease
    102271320 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    102271320 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102271320 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102271320 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102271320 (MAPK14)
   05135 Yersinia infection
    102271320 (MAPK14)
   05133 Pertussis
    102271320 (MAPK14)
   05152 Tuberculosis
    102271320 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102271320 (MAPK14)
   05161 Hepatitis B
    102271320 (MAPK14)
   05171 Coronavirus disease - COVID-19
    102271320 (MAPK14)
   05163 Human cytomegalovirus infection
    102271320 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102271320 (MAPK14)
   05169 Epstein-Barr virus infection
    102271320 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102271320 (MAPK14)
   05140 Leishmaniasis
    102271320 (MAPK14)
   05142 Chagas disease
    102271320 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102271320 (MAPK14)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102271320 (MAPK14)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102271320 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 102271320
NCBI-ProteinID: XP_005890568
LinkDB
Position
Un
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagaccatctgggaggtg
cccgagcgttaccagaacctgtccccggtgggctccggcgcctatggctccgtgtgtgct
gcttttgacacaaaaactgggttacgtgtcgcagtgaagaagctatccagaccatttcag
tccattattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaagcat
gaaaatgtaattggtctgttggatgttttcacacctgcaaggtctctggaggaattcaat
gatgtgtacctggtgacccatctcatgggggcagatctgaacaacatcgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccagattctcagaggtctcaagtat
atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcttggatttcggactggctcgacatacagatgatgaaatgaca
ggctatgtggccaccaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacctgctggagaagatgcttgtattggactcagataagagaatcacagcagca
caagcccttgcacatgcctacttcgcccagtaccacgatcctgacgacgaaccagtggct
gatccttacgatcagtcttttgaaagcagggacctccttatagacgaatggaaaagcctg
acctatgatgaagtcatcagctttgtgccgccaccccttgaccaagaagagatggagtct
tga

KEGG   Bos mutus (wild yak): 102285848
Entry
102285848         CDS       T02919                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04015  Rap1 signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04114  Oocyte meiosis
bom04218  Cellular senescence
bom04261  Adrenergic signaling in cardiomyocytes
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04714  Thermogenesis
bom04722  Neurotrophin signaling pathway
bom04723  Retrograde endocannabinoid signaling
bom04728  Dopaminergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04912  GnRH signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04917  Prolactin signaling pathway
bom04926  Relaxin signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05133  Pertussis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05205  Proteoglycans in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102285848 (MAPK12)
   04015 Rap1 signaling pathway
    102285848 (MAPK12)
   04370 VEGF signaling pathway
    102285848 (MAPK12)
   04668 TNF signaling pathway
    102285848 (MAPK12)
   04068 FoxO signaling pathway
    102285848 (MAPK12)
   04071 Sphingolipid signaling pathway
    102285848 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102285848 (MAPK12)
   04218 Cellular senescence
    102285848 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102285848 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102285848 (MAPK12)
   04620 Toll-like receptor signaling pathway
    102285848 (MAPK12)
   04621 NOD-like receptor signaling pathway
    102285848 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    102285848 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    102285848 (MAPK12)
   04660 T cell receptor signaling pathway
    102285848 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    102285848 (MAPK12)
   04659 Th17 cell differentiation
    102285848 (MAPK12)
   04657 IL-17 signaling pathway
    102285848 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    102285848 (MAPK12)
   04670 Leukocyte transendothelial migration
    102285848 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102285848 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    102285848 (MAPK12)
   04917 Prolactin signaling pathway
    102285848 (MAPK12)
   04926 Relaxin signaling pathway
    102285848 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    102285848 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102285848 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    102285848 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    102285848 (MAPK12)
   04722 Neurotrophin signaling pathway
    102285848 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102285848 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102285848 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    102285848 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102285848 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102285848 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102285848 (MAPK12)
   05020 Prion disease
    102285848 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    102285848 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102285848 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102285848 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102285848 (MAPK12)
   05135 Yersinia infection
    102285848 (MAPK12)
   05133 Pertussis
    102285848 (MAPK12)
   05152 Tuberculosis
    102285848 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102285848 (MAPK12)
   05161 Hepatitis B
    102285848 (MAPK12)
   05171 Coronavirus disease - COVID-19
    102285848 (MAPK12)
   05163 Human cytomegalovirus infection
    102285848 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102285848 (MAPK12)
   05169 Epstein-Barr virus infection
    102285848 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102285848 (MAPK12)
   05140 Leishmaniasis
    102285848 (MAPK12)
   05142 Chagas disease
    102285848 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102285848 (MAPK12)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102285848 (MAPK12)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102285848 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like UvrD_C
Other DBs
NCBI-GeneID: 102285848
NCBI-ProteinID: XP_005903977
LinkDB
Position
Un
AA seq 346 aa
MPVWVAFWPVTEAGPHARPCSSAYDTRLRQRVAVKKLSRPFQSLIHARRTYRELRLLKHL
KHENVIGLLDVFTPDETLDDFMDFYLVMPFMGTDLGKLMKHEKLSEDRVQFLVYQTLKGL
KYIHAAGVIHRDLKPSNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWM
HYTQTVDIWSVGCIMAEMITGKTLFKGNDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNY
MKGLPELEKKDFASVLTNASPLAVSLLEKMLVLDAERRVTAAEALAHPYFESLHDTEDDP
QAEKYDESFDDMDRTLDEWKRVTYKEVLSFKPPRQLGAKVSKETAL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgcccgtgtgggtggccttctggccagtcaccgaggcggggcctcacgcgcggccttgc
agctcggcctacgacacgcggctgcgccagagggtggcggtgaagaagctgtcgcggccc
ttccagtctctgatccatgcgcggaggacctaccgggagctgcggctgctcaaacacctg
aagcacgagaacgtgattgggctgctggacgtgttcacgcccgatgagacgctggatgac
ttcatggacttctacctggtgatgccgttcatgggcaccgacctgggaaagctcatgaag
cacgagaagctgagcgaggaccgggtgcagttcctcgtctaccagacgctcaaggggctg
aagtacatccacgctgccggcgtcatccacagggacctgaagcctagcaacctggctgtg
aacgaggactgtgagctgaagatcctggactttggcctggcccggcaggcagacagcgag
atgaccggctacgtggtgacccggtggtaccgcgcgcccgaggtcatcttgaactggatg
cactacacgcagacggtggacatctggtccgtgggctgcatcatggccgagatgatcacg
gggaagacactcttcaaaggcaacgaccacctggaccagctgaaggagatcatgaaggtg
acggggacgcctcccgcggagtttgtgcagaggctgcaaagtgatgaggccaagaactac
atgaagggcctccctgagctggagaagaaggattttgcctccgtcctgaccaacgcgagc
cccctggccgtgagcctcctggagaaaatgctggtgctggatgcggagcggcgggtgacg
gcggccgaggcgctggcccacccctactttgagtcgctgcacgacacggaggacgatccc
caggccgagaagtacgatgagtcctttgacgacatggaccgcacgctggacgagtggaag
cgtgtcacatataaagaggtgctcagcttcaagcctccccggcagctgggggccaaggtc
tccaaggagacagccttgtga

KEGG   Bos mutus (wild yak): 106701244
Entry
106701244         CDS       T02919                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04015  Rap1 signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04114  Oocyte meiosis
bom04218  Cellular senescence
bom04261  Adrenergic signaling in cardiomyocytes
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04714  Thermogenesis
bom04722  Neurotrophin signaling pathway
bom04723  Retrograde endocannabinoid signaling
bom04728  Dopaminergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04912  GnRH signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04917  Prolactin signaling pathway
bom04926  Relaxin signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05133  Pertussis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05205  Proteoglycans in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106701244 (MAPK11)
   04015 Rap1 signaling pathway
    106701244 (MAPK11)
   04370 VEGF signaling pathway
    106701244 (MAPK11)
   04668 TNF signaling pathway
    106701244 (MAPK11)
   04068 FoxO signaling pathway
    106701244 (MAPK11)
   04071 Sphingolipid signaling pathway
    106701244 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106701244 (MAPK11)
   04218 Cellular senescence
    106701244 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106701244 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106701244 (MAPK11)
   04620 Toll-like receptor signaling pathway
    106701244 (MAPK11)
   04621 NOD-like receptor signaling pathway
    106701244 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    106701244 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    106701244 (MAPK11)
   04660 T cell receptor signaling pathway
    106701244 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    106701244 (MAPK11)
   04659 Th17 cell differentiation
    106701244 (MAPK11)
   04657 IL-17 signaling pathway
    106701244 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    106701244 (MAPK11)
   04670 Leukocyte transendothelial migration
    106701244 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    106701244 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    106701244 (MAPK11)
   04917 Prolactin signaling pathway
    106701244 (MAPK11)
   04926 Relaxin signaling pathway
    106701244 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    106701244 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106701244 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    106701244 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    106701244 (MAPK11)
   04722 Neurotrophin signaling pathway
    106701244 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    106701244 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106701244 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    106701244 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    106701244 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106701244 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    106701244 (MAPK11)
   05020 Prion disease
    106701244 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    106701244 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106701244 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106701244 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106701244 (MAPK11)
   05135 Yersinia infection
    106701244 (MAPK11)
   05133 Pertussis
    106701244 (MAPK11)
   05152 Tuberculosis
    106701244 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106701244 (MAPK11)
   05161 Hepatitis B
    106701244 (MAPK11)
   05171 Coronavirus disease - COVID-19
    106701244 (MAPK11)
   05163 Human cytomegalovirus infection
    106701244 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106701244 (MAPK11)
   05169 Epstein-Barr virus infection
    106701244 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106701244 (MAPK11)
   05140 Leishmaniasis
    106701244 (MAPK11)
   05142 Chagas disease
    106701244 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    106701244 (MAPK11)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106701244 (MAPK11)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106701244 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Cas_CT1975
Other DBs
NCBI-GeneID: 106701244
NCBI-ProteinID: XP_014336342
LinkDB
Position
Un
AA seq 246 aa
MGADLNNIVKCQALSDEHVQFLVYQLLRGLKDLKPSNVAVNEDCELRILDFGLARQADEE
MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEV
VGTPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFRGANPLAVDLLGRMLVLDSDQRVS
AAEALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPPEPPQPLG
SLDVEQ
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggcgccgacctgaacaacatcgtcaagtgccaggcgctgagtgacgagcacgtccag
ttcctcgtgtaccagctgctgcgcgggctaaaggacctgaagcccagcaacgtggccgtg
aacgaggactgcgagctgcggatcctggacttcgggctagcgcgccaggcagacgaggag
atgactggctacgtggccacacgatggtacagggcccccgagatcatgctgaactggatg
cactacaaccagacagtggacatttggtccgtgggctgcatcatggctgagctgctccag
ggaaaggctctcttccccggaagtgactacatcgaccagctgaagcgtatcatggaggtg
gtgggcacacccagtcctgaggttctagcaaagatatcctcggaacatgcccggacctac
atccagtccctgccccccatgccccagaaggacctcaggagcatcttccgcggagccaac
cccctggctgtggacctcctgggcaggatgctggtgctggacagtgaccagagggtcagc
gcggcagaggccctggcacacgcctacttcagccagtaccacgacccggacgacgagccc
gaggcggagccttacgacgagagcgtggaggccaaggagcgcacggtggaggagtggaag
gagctcacgtaccaggaagtcctcagcttcaagcccccagagcccccgcagccgctgggc
agcctggacgttgagcagtga

DBGET integrated database retrieval system