KEGG   Bos mutus (wild yak): 102271072Help
Entry
102271072         CDS       T02919                                 

Gene name
PRSS2
Definition
(RefSeq) protease, serine 2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04080  Neuroactive ligand-receptor interaction
bom04972  Pancreatic secretion
bom04974  Protein digestion and absorption
bom05164  Influenza A
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102271072 (PRSS2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102271072 (PRSS2)
   04974 Protein digestion and absorption
    102271072 (PRSS2)
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    102271072 (PRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bom01002]
    102271072 (PRSS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102271072 (PRSS2)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102271072 (PRSS2)
Peptidases [BR:bom01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102271072 (PRSS2)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102271072 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 102271072
NCBI-ProteinID: XP_005900973
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MHPLLILAFVGAAVAFPSDDDDKIVGGYTCAENSVPYQVSLNAGYHFCGGSLINDQWVVS
AAHCYQYHIQVRLGEYNIDVLEGGEQFIDASKIIRHPKYSSWTLDNDILLIKLSTPAVIN
ARVSTLALPSACASAGTECLISGWGNTLSSGVNYPDLLQCLEAPLLSHADCEASYPGQIT
NNMICAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKGKPGVYTKVCNYVDWIQ
ETIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccctgctgatccttgcctttgtgggagctgctgtggctttcccctcggacgac
gatgacaagatcgtcgggggctacacctgcgcggagaattctgtcccttaccaggtgtcc
ctgaatgctggctaccacttctgcgggggctccctcatcaatgaccagtgggtggtgtcc
gcggctcactgctaccagtaccacatccaggtgaggctgggagaatacaacattgatgtc
ttggagggtggtgagcagttcatcgatgcgtccaagatcatccgccaccccaagtacagc
agctggactctggacaatgacatcctgctgatcaaactctccacgcctgcagtcatcaat
gcccgggtgtccaccttggctctgcccagtgcctgtgcttccgcaggcaccgagtgcctc
atctccggctggggcaacaccctgagcagtggcgtcaactacccggacctgctgcaatgc
ctggaggccccgctgctgagccacgctgactgtgaagcctcgtaccctggacagatcact
aacaacatgatctgcgctggcttcctggagggaggcaaggattcctgccagggtgactct
ggcggccctgtggcttgcaacggacagctccagggcattgtgtcctggggctacggctgt
gcccagaagggcaagcctggggtctacaccaaggtctgcaactacgtggactggattcag
gagaccattgccgccaacagctga

DBGET integrated database retrieval system