KEGG   Bos mutus (wild yak): 102271174Help
Entry
102271174         CDS       T02919                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00590  Arachidonic acid metabolism
bom01100  Metabolic pathways
bom04064  NF-kappa B signaling pathway
bom04370  VEGF signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04668  TNF signaling pathway
bom04723  Retrograde endocannabinoid signaling
bom04726  Serotonergic synapse
bom04913  Ovarian steroidogenesis
bom04921  Oxytocin signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom05140  Leishmaniasis
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05200  Pathways in cancer
bom05204  Chemical carcinogenesis
bom05206  MicroRNAs in cancer
bom05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102271174 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102271174 (PTGS2)
   04064 NF-kappa B signaling pathway
    102271174 (PTGS2)
   04668 TNF signaling pathway
    102271174 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102271174 (PTGS2)
   04657 IL-17 signaling pathway
    102271174 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102271174 (PTGS2)
   04913 Ovarian Steroidogenesis
    102271174 (PTGS2)
   04921 Oxytocin signaling pathway
    102271174 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    102271174 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102271174 (PTGS2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    102271174 (PTGS2)
   05206 MicroRNAs in cancer
    102271174 (PTGS2)
   05204 Chemical carcinogenesis
    102271174 (PTGS2)
   05222 Small cell lung cancer
    102271174 (PTGS2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    102271174 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102271174 (PTGS2)
   05165 Human papillomavirus infection
    102271174 (PTGS2)
   05140 Leishmaniasis
    102271174 (PTGS2)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102271174 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 102271174
NCBI-ProteinID: XP_005901335
UniProt: L8IA31
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAAVALSGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPPTYNVHY
SYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGT
NLMFAFFAQHFTHQFFKTDFERGPAFTKGKNHGVDLSHIYGESLERQHKLRLFKDGKMKY
QMINGEMYPPTVKDTQVEMIYPPHVPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGLTQFVESFTRQRAGRV
AGGRNLPVAVEKVSKASIDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEAL
YGDIDAMEFYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICSNVKGCPFTSFSVQDTHLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgggccctgctgctctgcgctgccgtggcgctcagcggtgcagcaaaccct
tgctgttcccatccatgccagaatcgaggtgtatgtatgagtgtaggatttgaccagtat
aaatgtgactgtacccgaacaggattctacggtgaaaactgtaccacacccgaatttctg
acaagaataaaattactcctgaaacccactcccaacacagtgcactacatacttacccac
ttcaaaggagtctggaacattgtcaataagatctccttcctgcgaaatatgattatgaga
tatgtgttgacgtcgagatcacatttgattgagagtccgccaacttataatgtgcactac
agctataaaagctgggaagccttttctaacctgtcttattataccagagctcttcctcct
gtgcctgatgactgcccaacacccatgggtgtgaaagggaggaaagagcttcctgattcg
aaagaagttgtgaaaaaagtacttctaagaagaaagttcattcctgatccccagggcaca
aatctgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatttt
gaacgaggaccagctttcactaagggaaagaaccatggggtggacttaagtcacatttat
ggtgaatctttagagagacagcataagctgcgccttttcaaggatggaaaaatgaaatat
cagatgattaatggagagatgtatcctcccacagtcaaagatactcaggtcgaaatgatc
tacccgcctcatgttcctgaacacttgaagtttgctgtgggccaggaagtctttggtctg
gtgcctggtctgatgatgtatgccaccatttggctgcgggaacacaacagagtgtgtgat
gtgcttaaacaagagcatccagaatggggcgatgagcagttgttccagacaagcaggcta
atcctgataggagaaactattaagattgtgattgaagactacgtacagcacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacagttccagtaccag
aaccgtattgctgctgagtttaacacgctgtaccactggcatccccttctgcctgacgtc
tttcagattgatggtcaggagtacaactatcagcagtttatctataacaactctgtctta
ctggaacatggtctcactcagtttgttgaatcattcaccaggcaaagggctggcagggtc
gctggcggtaggaatcttccagtcgcagtagagaaagtatcaaaggcttcaattgaccag
agcagagagatgaaataccagtcttttaatgagtatcgcaaacgttttctgctgaagccc
tatgaatcatttgaggaacttacaggagagaaggaaatggctgcagagttagaagcgctc
tatggagacatagatgccatggagttttatcccgcccttctggtagagaagccccgtcca
gacgccatctttggggagaccatggtagaagctggagcaccattctccctgaaaggactt
atgggtaatcctatatgctctcccgagtactggaagcctagcactttcggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcagtaacgtgaaaggc
tgtccctttacctcattcagtgttcaagatacgcacctcaccaaaacggtcaccattaat
gcaagctcttcccactctggactagatgatatcaaccccacagtcctactaaaggaacgt
tcaaccgaactgtag

DBGET integrated database retrieval system