KEGG   Bos mutus (wild yak): 102271361Help
Entry
102271361         CDS       T02919                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04020  Calcium signaling pathway
bom04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102271361 (CACNA1E)
   04020 Calcium signaling pathway
    102271361 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102271361 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bom04040]
    102271361 (CACNA1E)
Ion channels [BR:bom04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102271361 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DPBB_1
Motif
Other DBs
NCBI-GeneID: 102271361
NCBI-ProteinID: XP_005901630
LinkDB All DBs
Position
Un
AA seq 2311 aa AA seqDB search
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMARDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLSAHPSLYRRPRAIEGLALGL
GLEKCEEERVSRGGSLKGDGGDLASALDSQRSPLALGKREPPWLARPCHGNCDPTQPEAG
SGETVVTFGDRARHRQSQRRSRHRRVRTEGREPSSTSRSRSASQERSLDEAVPSEGERDR
EPRAGHGGKEPMIQEEERERCQDLRRTNSLMVPRGSGLAGALDEADTPLVPPQPELEVGK
DAALTEQEPEGSSEQALLGDVKLDMGRVSQSEPDLSCVTANTDKATTESTSVTVTIPDVG
PLVDSTVVHISNKTDGEASPLKEAEIREDEEEVEKKQQKKEKRETGKAMVPHSSMFIFST
TNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFT
FEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLR
VLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYC
TDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVL
QHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECS
LEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMK
YYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEII
LTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLF
FIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGC
EPDTTAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGP
HHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVA
EDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMP
KASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKAL
PYLQQDPVPGLSGRSAYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQP
SNHGIYLPSDTQEHAGSGKASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFS
MERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVS
RCNSEERGTQADWESPERHQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDSSTPRRSRRQ
LPPVPPKPRPLLSYSSLIRHAGSISPPADGSEGGSPLTSQALESNDAGLPESSNPRQGHP
SPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSPPPLRHSWQMPNGH
YRRRRRGGPGPGTTCGAVSDLLSDTEEDDKC
NT seq 6936 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggcgatggagactcggac
cagagcaggaaccggcaaggaacccccgtgccggcctccgggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccctattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcttggccaccatcatt
gccaattgcatcgtcttggccctggagcaacatcttcctgaggatgacaagaccccaatg
tcccgcagactggagaagacagaaccctatttcattgggatcttttgctttgaagctggg
atcaaaatcgtggccctggggttcatcttccataagggatcatacctccgcaatggttgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggctactgcgggaacccacttc
aacacccatgtggacctgaggaccctccgggccgtgcgtgtcctgaggcccctgaagctc
gtgtcggggatacctagcctacagattgtgttgaaatccatcatgaaggccatggtgcct
ctcctgcagattggccttctgctcttctttgccatcctgatgtttgctatcatcggcttg
gagttctacagtggaaagttgcaccgagcgtgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggcgtgcagggctgcccagctggttatgaatgccgg
gactggatcggccccaatgatgggatcacccagtttgataacatcctttttgccgtgctg
actgtcttccagtgtatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaaccttgtcctgggagtgctttccggggaatttgccaaagagagagagaga
gtggagaaccggagagccttcatgaaactgcggcgccagcagcagatcgagcgtgagctt
aacgggtaccgtgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaacaaa
aatgctggaacgtcagccttagaagtgcttcggagggcaaccatcaaaaggagccggacc
gaggccatggcacgggactccagcgatgagcactgcgtggacatctcctctgtgggcaca
cctctcgcccgagccagcatcaagagcgccaaggtggacggggcctcctatttccggcac
aaggagcgacttttgcggatctctatccgccacatggttaagtcccaggtcttctactgg
atcgtgctgagcctggtggctctcaacaccgcctgtgtggccattgtccaccacaaccag
ccccagtggctcacccatcttctctactatgcagagtttctgtttctggggctcttcctt
ctagagatgtccctgaagatgtacggcatggggcctcgcctttattttcactcttccttc
aactgctttgactttggggtcacagtgggcagcatctttgaagtagtctgggccatcttc
agacctggtacatctttcggaatcagtgtcctgcgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatccctccggaatttggtggtctccttgatgagttccatg
aagtctatcatcagtttactcttcctccttttcctcttcattgttgtctttgctctgcta
ggaatgcagctgtttgggggcaggttcaactttaatgatgggactccttccgcaaacttt
gacaccttccctgcagccatcatgactgtattccagatcctgacgggtgaggactggaat
gaggtgatgtacaacgggatccgctcccagggtggggtcagctcgggcatgtggtctgcg
atctatttcattgtgctcaccttgtttggaaactacacactgctgaatgtgttcttggcc
atcgctgtggacaatctggccaatgcccaggagctgaccaaggatgaacaagaagaagag
gaggccttcaaccagaagcacgcactgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttccatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcatcacatgtccgtgtgggagcag
cgaaccagccagttgaggaggcacatgcagatgtccagccaggaggccctcaacaaggag
gaggccccgcccatgaaccccctcaaccccctcaacccgctgagccccctcaacccgctc
agcgcgcaccccagcctctaccggagaccccgggccatcgaggggctagccctgggcctg
gggctggagaagtgtgaggaagagcgcgtcagccgtggggggtccctcaaaggggatgga
ggggacttggcgagcgccctggacagccagaggagccccctggccctgggcaaacgggag
ccaccctggctggcccggccctgtcacgggaactgtgacccgacccagccggaggcgggc
agtggggagacggtggtgaccttcggggaccgggcccggcacaggcagagccagcggcgc
agccggcaccgccgcgtcaggaccgagggtagggagccctcctccacctccagaagcagg
tctgccagccaggagcggagtctggatgaagctgtgcccagcgagggggagagggaccgt
gagcccagggccggccatgggggcaaagaacccatgatccaggaggaagagcgagagcga
tgccaggacttacggaggaccaacagtctgatggtgcccagaggctccgggctggcagga
gccctggatgaggccgacacaccccttgtcccaccccagccggagctggaagtggggaag
gacgcagccctgacggagcaggagccggagggcagcagtgagcaggctctgctgggggac
gtgaagctggacatgggccgggtcagccagagcgagcccgacctctcctgcgtcacggcc
aacacggacaaggccaccaccgagagcaccagcgtcactgtcaccatccccgacgtgggc
cccttggtggactcaaccgtggtgcacatcagcaacaagactgatggagaagccagtccc
ttgaaagaggcagagatcagagaggatgaggaggaggtggagaagaagcagcagaagaag
gagaagcgtgagacgggcaaggccatggtgccccacagctcgatgttcatcttcagcacc
accaacccgatccgcagggcctgccactacatcgtgaacctgcgctacttcgagatgtgc
atcctcctggtgatcgcagccagcagcatcgccctggcggccgaggaccccgtcctgacc
aactcagagcgcaacaaagtgctgaggtattttgactatgtgttcactggcgtgttcacc
tttgagatggttataaagatgatagaccagggcttgattctgcaggacggctcctacttc
cgagacctgtggaacatcctggacttcgtggtggtggttggtgcattggtggcctttgct
ctggcgaatgctttgggaactaacaagggccgggatattaagaccatcaagtccctgagg
gttctccgtgtcctgaggccgctgaagaccatcaagcgcctgcccaagctcaaggctgtc
ttcgactgtgtggtcacctccttgaaaaacgtcttcaacatactcattgtctacaagctc
ttcatgttcatctttgctgtcatcgcagttcagcttttcaagggcaagttcttctactgc
acggacagttccaaggacacagagaaggagtgcataggcaactatgtagatcatgagaaa
aacaagatggaggtgaaaggccgagagtggaagcgccatgaattccattatgacaacatc
atctgggctctgctgaccctcttcactgtctccacaggggaagggtggcctcaagtcttg
cagcactcggtcgatgtgacagaggaagaccgaggcccaagccgcagcaaccggatggag
atgtccatcttttatgtggtctactttgtggtcttccctttcttctttgtcaacatcttt
gtggctctcatcatcatcaccttccaggagcaaggggacaagatgatggaagagtgcagc
ctggagaagaacgagagggcatgcatcgacttcgccatcagcgccaaaccgctcacccgc
tacatgccccagaacaggcacaccttccagtaccgcgtctggcacttcgtggtgtctcca
tcctttgagtacaccatcatggccatgatcgccctgaacaccgtcgtgctgatgatgaag
tactactctgctccctgtacctatgagctggccctgaagtacctaaatatcgccttcacc
atggtgttttccctggaatgtgtcctgaagatcattgcatttggcttcttgaactatttc
cgagacacctggaatatctttgacttcatcactgtgattggcagtatcacagaaattatt
ctgacggacagcaagctggtgaacactagtggcttcaacatgagctttctgaagctcttc
cgagcggcccgcctcatcaagctgctgcgtcagggctacaccatccgcattttactgtgg
accttcgtgcagtcctttaaggcccttccctatgtctgccttctgatcgccatgcttttc
ttcatctacgccatcattgggatgcaggtctttggaaacataaagttagatgaggagagt
cacatcaaccggcacaacaacttccggagtttctttgggtccctcatgctgctcttcagg
agtgccacgggtgaggcctggcaggagataatgctgtcgtgtctcggggagaagggctgt
gagcccgacaccactgcgccgtcggggcagagcgagagcgagcgctgtggcaccgacctg
gcctacgtgtacttcgtctccttcatcttcttctgctccttcctgatgctcaacctgttc
gtggccgtcatcatggacaactttgagtacctgactcgggactcgtccatcctggggcct
caccatctggacgagtttgtccgagtctgggcagagtatgacagagcagcatgtggccgc
atccattacactgagatgtatgaaatgctgactctcatgtcaccgccgctaggcctcggc
aagagatgtccctccaaggtggcatataagaggttggtcttgatgaacatgccagtggcc
gaggacatgaccgtccacttcacttccacgctgatggctctaatccggacagctctggac
attaaaatcgccaaaggcggtgcagacaggcagcagctagactcagagctccagaaggag
accctggccatctggcctcacctgtcccagaagatgctggatctgctcgtgcccatgccc
aaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactac
aaacagagcaaggtgaagaagcagaggcagcagctggaggaacagaaaaacgcacccatg
ttccagcgcatggagccctcgtctctgcctcaggagatcatcgctaatgccaaagccctg
ccttatctccagcaggaccccgttccaggcctgagtggccggagtgcatacccttcgatg
agtccactctccccgcaggaaatattccagttggcctgtatggacccagctgatgatgga
cagttccaggaacaacaatctctggagccagaggttagtgaattaaaaagcgtgcagccc
tctaaccatggcatctaccttccttcggacacccaggagcatgcgggctctgggaaggca
tcctctatgccacgcctgactgtggatccccaggtggtgacagaccccagctccatgaga
cgttcattttccaccattcgcgataagcgttcaaattcctcgtggctggaggaattctcc
atggagcgaagcagcgaaaacacctacaagtcccggcgccggagttaccactcctccctg
aggctgtcagcccaccgtctgaactcggactcaggccacaagtccgacacccaccgctca
gggggcagagagcggggacgatcgaaagagcgaaagcatcttctctctcctgacgtctcc
cgctgcaactccgaggagcgagggacccaggctgactgggagtccccagagcgccatcag
tcccggtctcccagtgaaggcaggtcacagacccccaacagacagggcacggggtccctg
agtgagagctccatcccctctgtctccgactccagcaccccacgacgaagtcggcggcag
ctccccccagtccctcccaagcctcggcccctcctttcctacagctctctgatcagacac
gctgggagcatctccccaccagctgatgggagcgagggtggctccccactgacctcccaa
gctctggagagcaacgacgccggcctgcccgagtcttccaacccccggcagggccacccc
tccccacagcgctacatctccgagccctacctggccctgcacgaagactcccacgcctcg
gactgcggcgaggaggagacgctcacctttgaagcagccgtggccaccagcctgggccgg
tccaacaccatcggctcgcccccgcccctgcggcacagctggcagatgcccaatgggcac
tatcggcggcggaggcgcggggggcctggaccgggcacgacgtgcggagctgtcagcgac
ctcctgagtgacacggaagaagacgacaaatgctag

DBGET integrated database retrieval system