Bos mutus (wild yak): 102271380 Help Entry 102271380         CDS       T02919                                  Definition (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism bom  Bos mutus (wild yak) Pathway bom01521   EGFR tyrosine kinase inhibitor resistance bom01524   Platinum drug resistance bom04014   Ras signaling pathway bom04064   NF-kappa B signaling pathway bom04115   p53 signaling pathway bom04137   Mitophagy - animal bom04140   Autophagy - animal bom04151   PI3K-Akt signaling pathway bom04210   Apoptosis bom04215   Apoptosis - multiple species bom04621   NOD-like receptor signaling pathway bom04630   JAK-STAT signaling pathway bom05012   Parkinson disease bom05014   Amyotrophic lateral sclerosis bom05022   Pathways of neurodegeneration - multiple diseases bom05145   Toxoplasmosis bom05162   Measles bom05166   Human T-cell leukemia virus 1 infection bom05168   Herpes simplex virus 1 infection bom05170   Human immunodeficiency virus 1 infection bom05200   Pathways in cancer bom05202   Transcriptional misregulation in cancer bom05212   Pancreatic cancer bom05220   Chronic myeloid leukemia bom05222   Small cell lung cancer bom05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102271380    04630 JAK-STAT signaling pathway     102271380    04064 NF-kappa B signaling pathway     102271380    04151 PI3K-Akt signaling pathway     102271380  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102271380    04137 Mitophagy - animal     102271380   09143 Cell growth and death    04210 Apoptosis     102271380    04215 Apoptosis - multiple species     102271380    04115 p53 signaling pathway     102271380  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102271380  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102271380    05202 Transcriptional misregulation in cancer     102271380   09162 Cancer: specific types    05212 Pancreatic cancer     102271380    05225 Hepatocellular carcinoma     102271380    05220 Chronic myeloid leukemia     102271380    05222 Small cell lung cancer     102271380   09164 Neurodegenerative disease    05012 Parkinson disease     102271380    05014 Amyotrophic lateral sclerosis     102271380    05022 Pathways of neurodegeneration - multiple diseases     102271380   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102271380    05170 Human immunodeficiency virus 1 infection     102271380    05162 Measles     102271380    05168 Herpes simplex virus 1 infection     102271380   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102271380   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102271380    01524 Platinum drug resistance     102271380  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bom01009]     102271380   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102271380   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bom02000]     102271380 Protein phosphatases and associated proteins [BR:bom01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102271380 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     102271380 Transporters [BR:bom02000]  Other transporters   Pores ion channels [TC:1]    102271380 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  BH4 Bcl-2 PHINT_rpt DUF3094 Motif Other DBs NCBI-GeneID:  102271380 NCBI-ProteinID:  XP_005906798 LinkDB All DBs Position Un AA seq 173 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEGTESDMEIPSAINGNPSWHVA DSPAVNGAIGHSRSLDARKMIPMTTVKQALREASNEFELRYQQTFSDLTSQLHITPGTAY QSFEQNGDWDTFVELYENNTTTESQKGQESFNCWSLMDVSVAGVVPLGLLFNS NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggaactagtggttgactttctctcttacaagctttcccagaaa ggatacagctggagtcagtttagtgatatggaagagaacagaactgagaccccagaaggg acagaatcagatatggaaatccccagtgccatcaatggcaacccatcctggcacgtggca gatagccctgcagtgaatggagccattggccacagcagaagcttggatgcccggaaaatg atccctatgacaacagtaaagcaagccctgagggaggcaagcaatgagtttgaactgagg taccaacagacattcagcgacctgacgtcccagctccacatcaccccagggacagcgtat cagagctttgaacagaatggtgactgggacacttttgtggaactctacgaaaacaataca acaacagagagccaaaagggtcaagagagcttcaactgctggtccctgatggacgtgagt gtggctggtgtggttccactgggcttgctcttcaactcataa

Bos mutus (wild yak): 102277355 Help Entry 102277355         CDS       T02919                                  Gene name BCL2L1 Definition (RefSeq) BCL2 like 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism bom  Bos mutus (wild yak) Pathway bom01521   EGFR tyrosine kinase inhibitor resistance bom01524   Platinum drug resistance bom04014   Ras signaling pathway bom04064   NF-kappa B signaling pathway bom04115   p53 signaling pathway bom04137   Mitophagy - animal bom04140   Autophagy - animal bom04151   PI3K-Akt signaling pathway bom04210   Apoptosis bom04215   Apoptosis - multiple species bom04621   NOD-like receptor signaling pathway bom04630   JAK-STAT signaling pathway bom05012   Parkinson disease bom05014   Amyotrophic lateral sclerosis bom05022   Pathways of neurodegeneration - multiple diseases bom05145   Toxoplasmosis bom05162   Measles bom05166   Human T-cell leukemia virus 1 infection bom05168   Herpes simplex virus 1 infection bom05170   Human immunodeficiency virus 1 infection bom05200   Pathways in cancer bom05202   Transcriptional misregulation in cancer bom05212   Pancreatic cancer bom05220   Chronic myeloid leukemia bom05222   Small cell lung cancer bom05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102277355 (BCL2L1)    04630 JAK-STAT signaling pathway     102277355 (BCL2L1)    04064 NF-kappa B signaling pathway     102277355 (BCL2L1)    04151 PI3K-Akt signaling pathway     102277355 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102277355 (BCL2L1)    04137 Mitophagy - animal     102277355 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     102277355 (BCL2L1)    04215 Apoptosis - multiple species     102277355 (BCL2L1)    04115 p53 signaling pathway     102277355 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102277355 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102277355 (BCL2L1)    05202 Transcriptional misregulation in cancer     102277355 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     102277355 (BCL2L1)    05225 Hepatocellular carcinoma     102277355 (BCL2L1)    05220 Chronic myeloid leukemia     102277355 (BCL2L1)    05222 Small cell lung cancer     102277355 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     102277355 (BCL2L1)    05014 Amyotrophic lateral sclerosis     102277355 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     102277355 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102277355 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     102277355 (BCL2L1)    05162 Measles     102277355 (BCL2L1)    05168 Herpes simplex virus 1 infection     102277355 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102277355 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102277355 (BCL2L1)    01524 Platinum drug resistance     102277355 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bom01009]     102277355 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102277355 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bom02000]     102277355 (BCL2L1) Protein phosphatases and associated proteins [BR:bom01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102277355 (BCL2L1) Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     102277355 (BCL2L1) Transporters [BR:bom02000]  Other transporters   Pores ion channels [TC:1]    102277355 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102277355 NCBI-ProteinID:  XP_005887975 UniProt:  L8J061 LinkDB All DBs Position Un AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLA DSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagtaaccgggagctggtggttgactttctctcttacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg acagaatcagatatggaaacccccagtgccatcaatggcaacgcatcctggcacctggcg gatagccctgctgtgaatggagccactggccacagcagaagctcggatgcccgggaagtg atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg taccgacgggcattcagcgacctgacgtcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system