KEGG   Bos mutus (wild yak): 102271380
Entry
102271380         CDS       T02919                                 

Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01524  Platinum drug resistance
bom04014  Ras signaling pathway
bom04064  NF-kappa B signaling pathway
bom04115  p53 signaling pathway
bom04137  Mitophagy - animal
bom04140  Autophagy - animal
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04215  Apoptosis - multiple species
bom04621  NOD-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom05012  Parkinson disease
bom05014  Amyotrophic lateral sclerosis
bom05022  Pathways of neurodegeneration - multiple diseases
bom05145  Toxoplasmosis
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05168  Herpes simplex virus 1 infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05212  Pancreatic cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102271380
   04630 JAK-STAT signaling pathway
    102271380
   04064 NF-kappa B signaling pathway
    102271380
   04151 PI3K-Akt signaling pathway
    102271380
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102271380
   04137 Mitophagy - animal
    102271380
  09143 Cell growth and death
   04210 Apoptosis
    102271380
   04215 Apoptosis - multiple species
    102271380
   04115 p53 signaling pathway
    102271380
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102271380
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102271380
   05202 Transcriptional misregulation in cancer
    102271380
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102271380
   05225 Hepatocellular carcinoma
    102271380
   05220 Chronic myeloid leukemia
    102271380
   05222 Small cell lung cancer
    102271380
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102271380
   05014 Amyotrophic lateral sclerosis
    102271380
   05022 Pathways of neurodegeneration - multiple diseases
    102271380
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102271380
   05170 Human immunodeficiency virus 1 infection
    102271380
   05162 Measles
    102271380
   05168 Herpes simplex virus 1 infection
    102271380
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102271380
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102271380
   01524 Platinum drug resistance
    102271380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102271380
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bom03036]
    102271380
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bom02000]
    102271380
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102271380
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102271380
Transporters [BR:bom02000]
 Other transporters
  Pores ion channels [TC:1]
   102271380
SSDB
Motif
Pfam: BH4 Bcl-2 PHINT_rpt DUF3094
Other DBs
NCBI-GeneID: 102271380
NCBI-ProteinID: XP_005906798
LinkDB
Position
Un
AA seq 173 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEGTESDMEIPSAINGNPSWHVA
DSPAVNGAIGHSRSLDARKMIPMTTVKQALREASNEFELRYQQTFSDLTSQLHITPGTAY
QSFEQNGDWDTFVELYENNTTTESQKGQESFNCWSLMDVSVAGVVPLGLLFNS
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggaactagtggttgactttctctcttacaagctttcccagaaa
ggatacagctggagtcagtttagtgatatggaagagaacagaactgagaccccagaaggg
acagaatcagatatggaaatccccagtgccatcaatggcaacccatcctggcacgtggca
gatagccctgcagtgaatggagccattggccacagcagaagcttggatgcccggaaaatg
atccctatgacaacagtaaagcaagccctgagggaggcaagcaatgagtttgaactgagg
taccaacagacattcagcgacctgacgtcccagctccacatcaccccagggacagcgtat
cagagctttgaacagaatggtgactgggacacttttgtggaactctacgaaaacaataca
acaacagagagccaaaagggtcaagagagcttcaactgctggtccctgatggacgtgagt
gtggctggtgtggttccactgggcttgctcttcaactcataa

KEGG   Bos mutus (wild yak): 102277355
Entry
102277355         CDS       T02919                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01524  Platinum drug resistance
bom04014  Ras signaling pathway
bom04064  NF-kappa B signaling pathway
bom04115  p53 signaling pathway
bom04137  Mitophagy - animal
bom04140  Autophagy - animal
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04215  Apoptosis - multiple species
bom04621  NOD-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom05012  Parkinson disease
bom05014  Amyotrophic lateral sclerosis
bom05022  Pathways of neurodegeneration - multiple diseases
bom05145  Toxoplasmosis
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05168  Herpes simplex virus 1 infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05212  Pancreatic cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102277355 (BCL2L1)
   04630 JAK-STAT signaling pathway
    102277355 (BCL2L1)
   04064 NF-kappa B signaling pathway
    102277355 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    102277355 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102277355 (BCL2L1)
   04137 Mitophagy - animal
    102277355 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    102277355 (BCL2L1)
   04215 Apoptosis - multiple species
    102277355 (BCL2L1)
   04115 p53 signaling pathway
    102277355 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102277355 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102277355 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    102277355 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102277355 (BCL2L1)
   05225 Hepatocellular carcinoma
    102277355 (BCL2L1)
   05220 Chronic myeloid leukemia
    102277355 (BCL2L1)
   05222 Small cell lung cancer
    102277355 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102277355 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    102277355 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    102277355 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102277355 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    102277355 (BCL2L1)
   05162 Measles
    102277355 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    102277355 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102277355 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102277355 (BCL2L1)
   01524 Platinum drug resistance
    102277355 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102277355 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bom03036]
    102277355 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bom02000]
    102277355 (BCL2L1)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102277355 (BCL2L1)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102277355 (BCL2L1)
Transporters [BR:bom02000]
 Other transporters
  Pores ion channels [TC:1]
   102277355 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102277355
NCBI-ProteinID: XP_005887975
UniProt: L8J061
LinkDB
Position
Un
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLA
DSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagtaaccgggagctggtggttgactttctctcttacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg
acagaatcagatatggaaacccccagtgccatcaatggcaacgcatcctggcacctggcg
gatagccctgctgtgaatggagccactggccacagcagaagctcggatgcccgggaagtg
atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg
taccgacgggcattcagcgacctgacgtcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system