KEGG   Bos mutus (wild yak): 102271416
Entry
102271416         CDS       T02919                                 

Definition
(RefSeq) intercellular adhesion molecule 1-like
  KO
K06490  intercellular adhesion molecule 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04064  NF-kappa B signaling pathway
bom04514  Cell adhesion molecules
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05143  African trypanosomiasis
bom05144  Malaria
bom05150  Staphylococcus aureus infection
bom05164  Influenza A
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05323  Rheumatoid arthritis
bom05416  Viral myocarditis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102271416
   04668 TNF signaling pathway
    102271416
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102271416
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102271416
   04670 Leukocyte transendothelial migration
    102271416
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102271416
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102271416
   05416 Viral myocarditis
    102271416
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102271416
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102271416
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102271416
   05164 Influenza A
    102271416
   05167 Kaposi sarcoma-associated herpesvirus infection
    102271416
   05169 Epstein-Barr virus infection
    102271416
  09174 Infectious disease: parasitic
   05144 Malaria
    102271416
   05143 African trypanosomiasis
    102271416
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102271416
CD molecules [BR:bom04090]
 Proteins
  102271416
Glycosaminoglycan binding proteins [BR:bom00536]
 Hyaluronan
  Cell surface receptors
   102271416
Lectins [BR:bom04091]
 I-type lectins (Siglecs)
  102271416
SSDB
Motif
Pfam: ICAM_N C2-set_2
Other DBs
NCBI-GeneID: 102271416
NCBI-ProteinID: XP_014339061
LinkDB
Position
Un
AA seq 280 aa
MALGAAPAAQLALLALLGTLLPGPGGAGISIHPSKAIIPRGDSLTVNCSNSCDQKSTFGL
ETVLIKEEVGRGDNWKVFQLRDVQEDIELFCYSNCHKEQTIASMNLTVYWFPEHVERAPL
PLXXXXXXXXXRQPVEKGDPAKVMFTVQPRREDHGTNFSCRWELDLRSQGLELFQNTSAP
RKLQTYVLPPTDPHLEVPRIVEVGSRWPVKCTLDGLFPASDAKVYLVLGDQKLESNITYD
GDSVLAKAWMEENEEGNHSLKCSVSLGEDGRRKRESVIVY
NT seq 841 nt   +upstreamnt  +downstreamnt
atggctctcggcgccgcccctgcagcacagcttgcgctcctggccctgctcgggactctg
ctcccagggcctggaggtgccggaatatcaatacatccttcaaaagctatcataccccgt
ggagactccctgacggtgaactgcagtaactcctgtgaccaaaagtcaacatttggccta
gagactgtattaatcaaggaggaagtgggccgtggggacaactggaaggtttttcaactg
cgtgatgtgcaggaagacatcgagctgttttgctactcaaactgtcacaaggaacagaca
atagcttcaatgaacctcaccgtatactggttcccggagcatgtggagcgggctcccctg
cccctcnnnnnnnnnnnnnnnnnnnnnnnnnnncggcagcccgtggaaaagggggacccc
gccaaggtcatgttcacagtgcagccgagaagagaggaccatggcaccaatttctcttgc
cgctgggaactggacctgcggtcacaagggctggaactcttccagaacacctcggccccc
aggaagctccagacctatgtcctgccaccgaccgacccgcaccttgaggtcccccggatt
gtggaagtaggctcacggtggccggtgaagtgcacgctggatggactgttcccagcctca
gacgctaaggtctacctggtgctgggggaccagaaactggaatccaatatcacgtacgat
ggtgactctgtcttggccaaggcctggatggaggaaaatgaggagggcaaccattccttg
aagtgttcagtgagtctgggagaggacggccggaggaagcgagagagcgtgattgtctac
a

KEGG   Bos mutus (wild yak): 102278214
Entry
102278214         CDS       T02919                                 

Definition
(RefSeq) intercellular adhesion molecule 1-like
  KO
K06490  intercellular adhesion molecule 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04064  NF-kappa B signaling pathway
bom04514  Cell adhesion molecules
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05143  African trypanosomiasis
bom05144  Malaria
bom05150  Staphylococcus aureus infection
bom05164  Influenza A
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05323  Rheumatoid arthritis
bom05416  Viral myocarditis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102278214
   04668 TNF signaling pathway
    102278214
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102278214
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102278214
   04670 Leukocyte transendothelial migration
    102278214
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102278214
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102278214
   05416 Viral myocarditis
    102278214
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102278214
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102278214
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102278214
   05164 Influenza A
    102278214
   05167 Kaposi sarcoma-associated herpesvirus infection
    102278214
   05169 Epstein-Barr virus infection
    102278214
  09174 Infectious disease: parasitic
   05144 Malaria
    102278214
   05143 African trypanosomiasis
    102278214
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102278214
CD molecules [BR:bom04090]
 Proteins
  102278214
Glycosaminoglycan binding proteins [BR:bom00536]
 Hyaluronan
  Cell surface receptors
   102278214
Lectins [BR:bom04091]
 I-type lectins (Siglecs)
  102278214
SSDB
Motif
Pfam: ICAM_N
Other DBs
NCBI-GeneID: 102278214
NCBI-ProteinID: XP_014338839
LinkDB
Position
Un
AA seq 456 aa
MAPGAAGAARLALLALLWTLLPGPGGAGTSIHPSEAIIPRGGSLRVNCSISCDQKAILSL
EAESAKKVVDRRNNWKVFELSDVQEDHMLLCISMCHSEVTMASMDLTVYWFPEHVELAPL
PLWQPVGEELNLSCLVSGGAPRAHLSVVLLRGEEEREHLATNFPCRSELDLRSQGLELFQ
NTSAPRKLQTYVLPSTDPHLEVPXVVEVGSRWPVKCTLDGLFPAWDAEVYVVLGDKRLET
IVTFHEYSVFAEAWIEGNEEEEGTHSLKCSVSLGNEIRNTRESVISTLKLPGSLPDLEPP
EVSGWTTVTMECEARAATVVTLNGAPAGPLGPRAHLQLSPSAQDNGRCLSCSAELEVAGL
VVQKHQTLELRVLXGPQLDQRDCPGNWTWQEGSEQTLMCEPWGNPIPKLNCSRKGDGASL
PIGDLRTVKREVAGTYLCRATSARGGVTQEVVVNML
NT seq 1369 nt   +upstreamnt  +downstreamnt
atggctcccggcgccgccggtgctgcgcggcttgcgctcctggccctgctctggactctg
ctgcccgggcctggaggtgccggaacatcaatacatccttcagaagccatcataccccga
ggaggctctctgagggtgaactgcagtatctcctgtgaccaaaaggcaattttgagccta
gaggctgaatcagccaagaaggtagtggaccgcaggaacaactggaaggtttttgaactg
agtgatgttcaagaagaccacatgctgttgtgcatctcaatgtgtcacagtgaagtgaca
atggcttccatggacctcaccgtatactggttcccggagcatgtggagctggctcccctg
cccctctggcagcctgtgggtgaagaactcaacctgagctgcctggtgtctggcggggcc
ccccgggcccacctctccgtggtgctgctccgaggggaggaggaaagagagcaccttgcc
accaatttcccctgccgctctgaactggacctgcggtcacaagggctggaactcttccag
aacacctcggcccccaggaagctccagacctatgtcctgccatcgaccgacccacacctt
gaggtccccntggttgtggaagtaggctcacggtggccggtgaagtgcacgctggatgga
ctgttcccagcctgggacgctgaggtctatgtcgtgctgggagacaagaggctggaaacc
atcgtcacgttccatgaatactccgtcttcgctgaggcctggatcgagggaaacgaggag
gaagagggcacccattccttgaagtgttcagtgagtctggggaacgagatccggaataca
cgagagagcgtgatttctacacttaagcttccaggctctctcccggaccttgagccaccc
gaggtctcaggatggactacagtgaccatggagtgtgaggcccgtgctgcaactgtggtg
acactgaacggagccccggctgggcctctgggcccgagggcccatttgcagctcagcccc
agtgcccaggacaatggacgctgtctctcctgctctgctgaactggaggtggctgggctg
gtggtccagaaacaccagaccctggagctccgtgtcctgtaaggcccccaactagaccag
cgggattgcccgggaaactggacgtggcaggaaggctcggagcagaccctgatgtgcgag
ccctgggggaacccaatccccaagctgaactgtagtcggaaaggggacggggcttcgctg
cccatcggggacctgaggactgtcaagcgggaggtggcgggcacctacctgtgtcgggcc
accagtgctcgtggtggagtcacccaggaagtggtcgtgaacatgctct

KEGG   Bos mutus (wild yak): 102288402
Entry
102288402         CDS       T02919                                 

Definition
(RefSeq) intercellular adhesion molecule 1-like
  KO
K06490  intercellular adhesion molecule 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04064  NF-kappa B signaling pathway
bom04514  Cell adhesion molecules
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05143  African trypanosomiasis
bom05144  Malaria
bom05150  Staphylococcus aureus infection
bom05164  Influenza A
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05323  Rheumatoid arthritis
bom05416  Viral myocarditis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102288402
   04668 TNF signaling pathway
    102288402
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102288402
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102288402
   04670 Leukocyte transendothelial migration
    102288402
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102288402
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102288402
   05416 Viral myocarditis
    102288402
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102288402
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102288402
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102288402
   05164 Influenza A
    102288402
   05167 Kaposi sarcoma-associated herpesvirus infection
    102288402
   05169 Epstein-Barr virus infection
    102288402
  09174 Infectious disease: parasitic
   05144 Malaria
    102288402
   05143 African trypanosomiasis
    102288402
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102288402
CD molecules [BR:bom04090]
 Proteins
  102288402
Glycosaminoglycan binding proteins [BR:bom00536]
 Hyaluronan
  Cell surface receptors
   102288402
Lectins [BR:bom04091]
 I-type lectins (Siglecs)
  102288402
SSDB
Motif
Pfam: Ig_2 C2-set_2 Ig_3 Ig_4
Other DBs
NCBI-GeneID: 102288402
NCBI-ProteinID: XP_014335989
LinkDB
Position
Un
AA seq 426 aa
FPEHVELAPLPLWQPVGEELNLSCLVSGGAPRAHLSVVLLRGEEELGRQPVGKGEPAEVM
FTVQPRREDHGTNFSCRWELDLRSQGLELFQNTSAPRKLQTYVLPPTLDPHLEVPPIVEV
GSRWPVKCTLDGLFPASDAKVYLVLGDQKLESNITYDGDSVLAKAWMEENEEGTHSLKCS
VSLGENSRRTQENVTVYSFPLPTLTLSPPEVSEWTTVTVECVTRDGAVVKLNGTSAVPPG
PRAQLKLNVSASDHRSNFSCSAALEIAGQVVHKHQTRELHVLYGPRLDQRDCPGNWTWQE
GSEQTLKCEAQGNPIPKLNCSRKGDGASLPIGDLRPVRREVAGTYLCRATSARGRVTREV
VLNVLHGQNILDIVIPVVAVTLILGALGTAGYVYNYQRKIQKYELQKARKAQEEAALKLN
AQSTPP
NT seq 1283 nt   +upstreamnt  +downstreamnt
ggttcccggagcatgtggagctggctcccctgcccctctggcagcctgtgggtgaagaac
tcaacctgagctgcctggtgtctggcggggccccccgggcccacctctccgtggtgctgc
tccgaggggaggaggagctgggccggcagcccgtgggaaagggggagcccgccgaggtca
tgttcacagtgcagccaagaagagaggaccatggcaccaatttctcttgccgctgggaac
tggacctgcggtcacaagggctggaactcttccagaacacctcggcccccaggaagctcc
agacctatgtcctgccaccgaccctcgatcctcaccttgaggtccccccgattgtggaag
taggctcacggtggccggtgaagtgcacgctggatggactgttcccagcctcagacgcta
aggtctacctggtgctgggggaccagaaactggaatccaatatcacgtacgatggtgact
ctgtcttggccaaggcctggatggaggaaaatgaggagggcacccattccttgaagtgtt
cagtgagtctgggagagaacagccggaggacgcaagagaacgtgactgtctatagcttcc
cgcttcccaccctgaccctgagtccgcctgaggtctcagaatggactactgtgactgtgg
aatgtgtgacccgtgatggagctgtggtgaagctgaatggaacctcagctgtgccgccgg
gtccgagggcccaattgaagctgaacgtcagtgccagcgaccacaggagcaacttctcct
gctctgctgccctggagatagctgggcaggtggtccacaaacaccagacccgggagctcc
atgtcctgtacggcccccgactagaccagcgggattgcccgggaaactggacgtggcagg
aaggctcggaacagaccctgaagtgcgaggctcaggggaacccaatccccaagctgaact
gtagccggaaaggggacggggcttcgctgcccatcggggacctgaggcccgttaggcggg
aggtggcgggcacctacctgtgtcgggccaccagcgctcgtggcagagtcacccgtgaag
tggtcctgaacgtgctccacggccagaatatcctggacattgtcattccggtagtagctg
tgaccctcatcttgggtgctctgggcaccgccggttatgtctataactaccagcggaaga
tccagaaatacgagctgcagaaggcccggaaggcccaagaagaggctgccttgaaactga
atgcacaatccacgccgccctga

DBGET integrated database retrieval system