KEGG   Bos mutus (wild yak): 102271432
Entry
102271432         CDS       T02919                                 

Gene name
PIAS4
Definition
(RefSeq) protein inhibitor of activated STAT 4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04064  NF-kappa B signaling pathway
bom04120  Ubiquitin mediated proteolysis
bom04630  JAK-STAT signaling pathway
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102271432 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102271432 (PIAS4)
   04064 NF-kappa B signaling pathway
    102271432 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102271432 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102271432 (PIAS4)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102271432 (PIAS4)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   102271432 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP CENP-B_dimeris
Other DBs
NCBI-GeneID: 102271432
NCBI-ProteinID: XP_005896019
UniProt: A0A6B0R7R3
LinkDB
Position
Un
AA seq 513 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKSSEPVPQPHRPLDPLTMHSTYERASSVPRTPLTGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGVKAVQVVLRICYSDTSSPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQCP
ILVLGTSDANGLLSTPSVNGGGGSVLGGAGSGGGPVGSVENGKPGADVVDLTLDSSSSSE
EEEEEEEDEEDEDEEGPRPKRRCPFQKGLVSAC
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcggcggaactggtggaggccaaaaacatggtgatgagtttccgagtctccgacctt
cagatgctcctgggttttgtcggccggagtaaaagtggacttaaacatgaacttgtcacg
cgggccctccagctggtccagtttgactgtagccccgagctgttcaagaaaatcaaggag
ctctatgagacacgctacgccaagaagagctcagagcctgtaccccaaccccaccggccc
ctggaccccctgaccatgcactccacctatgagcgggccagctcggtacccaggactccc
ctcacaggccccaacattgactatcccgtgctgtacgggaagtacttaaacggacttgga
cggttgcctgccaagactctcaagccagaagtgcgcctggtgaagctgcccttcttcaac
atgttggatgagttgctaaagcctaccgagctggttccacagaataacgagaagcttcag
gagagcccctgcatcttcgccttgacccccagacaggtggagctgatccggaactccaga
gaactgcagcctggggtcaaggccgtgcaggttgtcctaagaatctgctattcagacacc
agcagccctcaggaagaccagtacccacccaacatcgccgtgaaggtcaaccacagctac
tgctcggtgccgggctactacccctcaaacaagcctggagtggagcccaagaggccgtgc
cgccccatcaacctcacccacctcatgtacctgtcctcggccaccaaccgcatcactgtc
acctggggcaactacggcaagagttattccgtggccttgtacctggtgcggcagctgacc
tcctcggagctgctgcagaggttgaagaccatcggggtcaagcacccggagctgtgcaag
gcactggtcaaagagaagctgcgcctggaccctgacagtgagatcgccaccacgggcgtg
cgggtctccctcatctgcccgctggtgaagatgcgtctgtcggtgccctgccgcgcggag
acctgcgcgcacttgcagtgcttcgacgcagtcttctacctccagatgaacgagaagaag
cccacctggatgtgcccggtgtgtgacaagccggccccttatgaccagctcatcatcgac
gggctcctctccaagatcctgagcgagtgcgaggacgcggacgagattgagtacctggtg
gacggctcgtggtgcccgattcgcgccgagaaggagcgcagctgcagcccccagtgccct
atccttgtgctcggcacctcggacgccaatgggctcctctctacccccagcgtcaacggc
gggggcggcagcgtgcttgggggtgcgggcagtggaggcggcccagtgggcagcgtggag
aatgggaagccgggagctgatgtggtggacctaacgctggacagctcgtcgtcctcagaa
gaggaagaggaagaagaggaggatgaggaggacgaggacgaggagggcccccggccaaag
cgccgctgccccttccaaaagggtctggtgtcggcctgctga

KEGG   Bos mutus (wild yak): 102281021
Entry
102281021         CDS       T02919                                 

Gene name
PIAS2
Definition
(RefSeq) protein inhibitor of activated STAT 2
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04120  Ubiquitin mediated proteolysis
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102281021 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102281021 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102281021 (PIAS2)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     102281021 (PIAS2)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   102281021 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 102281021
NCBI-ProteinID: XP_005908138
LinkDB
Position
Un
AA seq 612 aa
MVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTL
EGLSDLSAIKSPVFSLDGSSSPVEPDLAVAGIHALPSTSVTPHSPSSPVGSVLLQDTKPA
FEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVR
EICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPK
NGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLK
MKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFD
AALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCTDVDEIKFQEDGSWCPMRP
KKEAMKVSTQPCPKIETSTVLSKPCAVTVANEPSKKKVDVIDLTVESSSDEEEGPPAKRK
CIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLP
GLDFLSLIPVDPQYCPPMFLDSLTSPLTASSASVTTTSPHESSTHVSSSSSRSETGVITS
SGSNIPDIISLD
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggtttctagttttagggtttctgaactacaagtgttactaggctttgccggacggaat
aaaagtggacgtaagcatgacctcctgatgagggcgttgcatttattgaagagtggctgc
agccctgcggttcagattaaaatccgagaattgtatagacgccgatacccgcggactctc
gaaggcctttctgatttatctgcaatcaaatcaccggttttcagtttggatggtagctcc
tcacctgtagaacctgacttggctgtggctggaatccacgcgttgccttccacttcagtt
acacctcattctccgtcctctcctgttggttctgtgctgcttcaagatactaaacccgca
tttgagatgcagcagccatctcccccaatccctcctgtccatcctgatgtgcagttaaaa
aacttacccttttatgatgtccttgatgttctcatcaagcccacgagtttagttcaaagc
agtattcagcggtttcaagagaagttttttatttttgctctcacacctcagcaagttaga
gagatatgcatatccagggattttttgccaggtggtaggagagattatacagtacaagtt
cagctgagactttgcctggcagagacaagttgtcctcaagaagataactatcccaatagt
ctctgtataaaagtgaatgggaagctgtttcctttgcctggctatgcaccaccacctaaa
aatggaattgagcagaagcgccctggacgccctttgaatatcacgtctttagttaggtta
tcctcagctgtgccaaaccagatttccatttcttgggcatcagaaattggaaagaattac
tccatgtctgtatatcttgtacgacaactcacatcagccatgttattacagagattaaaa
atgaaaggtattagaaaccctgatcattccagagcactaattaaagaaaaacttactgcg
gatcctgacagtgagattgctaccactagccttcgggtgtccttgatgtgccctttaggg
aaaatgaggctgacaatcccatgccgtgcggtgacttgtacacacctacagtgttttgat
gctgccctttatctgcaaatgaatgagaagaaacccacctggatttgtcctgtgtgtgac
aaaaaagctgcctatgaaagtctaattttagatgggctttttatggaaattctcaatgac
tgtactgatgtggacgagatcaaattccaagaagatggttcttggtgtccaatgagaccg
aagaaagaagctatgaaagtatccacccaaccatgtcccaaaatagaaacttcaactgtc
ctcagtaagccgtgtgcagtgactgtagccaatgagccaagcaagaagaaagtggatgtc
attgacctaacagtagaaagctcttctgatgaagaggaaggccctcctgccaaaaggaaa
tgcatctttatgtcagaaacacaaagcagcccaaccaaaggggttctcatgtatcagcca
tcttctgtaagggtgcccagtgtgacttcggttgatcctgctgctattccgccttcatta
acagactactcagtaccattccaccacacgccaatctcaagcatgtcctcagatctgcca
ggtttggattttctttcccttattccagttgatccccagtactgtcctcctatgtttttg
gatagtctcacctcacccttaacagcaagcagtgcgtctgtcaccaccaccagcccccat
gagagcagtactcatgttagttcatccagcagcaggagtgagacaggggtcataaccagc
agtggaagtaacattcctgacatcatctcactggactaa

KEGG   Bos mutus (wild yak): 102284133
Entry
102284133         CDS       T02919                                 

Gene name
PIAS1
Definition
(RefSeq) protein inhibitor of activated STAT 1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04120  Ubiquitin mediated proteolysis
bom04630  JAK-STAT signaling pathway
bom05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102284133 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284133 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102284133 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102284133 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bom04812]
    102284133 (PIAS1)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     102284133 (PIAS1)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   102284133 (PIAS1)
Cytoskeleton proteins [BR:bom04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    102284133 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 102284133
NCBI-ProteinID: XP_005893359
LinkDB
Position
Un
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKSKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPATNGSSSGSNSSLVSSNSLRESHGHSVANRSSSDTAAIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggagaaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgcagtcctgctgtacaaatgaaaattaaagaactc
tataggcggaggttcccccagaaaatcatgacgcctgcggacttgtccatccccaacgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacaactcacttatgat
ggtcaccctgcatcatcaccgttactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgcattgacgccacaacaagtgcagcag
atcagtagttccatggatatttctgggaccaaatgtgacttcacagtgcaggtccagtta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccaggttatcttccacctactaaaaatggt
gtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgattgtctaca
actgtaccaaacaccattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtgtatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaacccggatcattctagagctttaattaaagagaagttgactgcggatcca
gacagtgaaatagctacaaccagcctgagggtttctctactatgtccacttggtaaaatg
cggctgacaattccatgtcgggccctcacatgttctcatctgcagtgttttgatgcaact
ctttatattcagatgaatgagaaaaaaccaacttgggtttgtcctgtctgtgataagaag
gccccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgtaca
gattgtgatgaaatacagtttaaggaggacggctcttgggcacctatgagatcaaaaaag
gaagtacaggaagtttctgcctcttacaatggagttgatggatgcttaagctccacatta
gagcaccaagtggcttctcatcaccagtcttcaaataaaagtaagaaagtagaggtgatt
gatctaaccatagacagttcatcagatgaagaagaagaagagccatctgccaagagaacc
tgtccttccctgtctcccacatcgccactaaataataaaggcatactgagtcttccacat
caagcatctccagtgtcccgtaccccaagcctccctgctgtagacacaagctatattaac
acatccctcatccaagactacagacatcctttccacatgacacccatgccttatgactta
caaggattagatttctttcctttcttatcaggagacaatcagcactataacacctccctc
cttgctgcagcagcagcagcagtttcagatgatcaagacctcttacactcgtctcggttt
tttccatatacctcctcacagatgtttctcgatcagttaagtgcaggaggcagtacttct
ctgccagccaccaatggaagcagtagtggcagtaacagcagccttgtatcctccaacagc
ctaagggagagccatggccacagcgtcgcgaacaggagcagctcggacacggcagccatc
tttggcatcatcccagacattatttcactggactga

KEGG   Bos mutus (wild yak): 102286484
Entry
102286484         CDS       T02919                                 

Gene name
PIAS3
Definition
(RefSeq) protein inhibitor of activated STAT 3
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04120  Ubiquitin mediated proteolysis
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102286484 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102286484 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102286484 (PIAS3)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     102286484 (PIAS3)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   102286484 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 102286484
NCBI-ProteinID: XP_005898574
LinkDB
Position
Un
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTPPVGSPGPLAPIPPALLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEIYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSESKKKVEVIDLTVESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLTPTLGSSHRSATPAPPPGRVSSIVAPG
GTLREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgctcctcggctttgctggccggaacaagagtggacggaagcacgagctcctggccaag
gccctacacctcctcaagtctagctgtgcccccagcgtccagatgaagatcaaagagctt
taccgccgacgctttccccgcaagaccctggggccctctgatctttctctgctctccttg
ccccctggaacccctcctgtaggctctcctggtcctctggctcccatccccccggccctc
ttggcccctggcaccctgctgggccccaagcgtgaagtggacatgcaccctcctctaccc
cagcctgtgcaccctgacgttaccatgaaaccattgcccttctatgaaatctacggggag
ctcatccggcctaccaccctagcatccacttctagccagcggttcgaggaagcgcacttc
acctttgccctcaccccccagcaagtgcagcagattcttacttccagagaggttctgcca
ggagccaaatgcgattataccatacaggtgcagttaaggttctgtctctgtgagaccagc
tgcccccaggaagattacttcccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttccccctaccaagaacggggctgagcccaagagacccagccgc
cccatcaacatcacacccctggctcgtctctcggccactgttcccaacaccatcgtggtc
aactggtcgtctgagtttggacggaattactccttgtccgtgtacctggtgaggcagctg
acggcagggaccctgctacaaaaactcagagcaaagggcatccggaacccagaccactcc
cgggcactgatcaaggagaagttgaccgctgacccggacagtgaggtggctactacgagt
ctccgggtgtcactcatgtgcccgctggggaagatgcgcttgactgtcccttgtcgcgcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aaaccaacatggacatgtcctgtgtgtgacaagaaagctccctatgaatctcttatcatt
gatggtttattcatggagattcttaattcctgctcggattgtgatgagatccagttcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtatagcccagtccaagagggcaatccatcggag
agtaagaagaaggttgaagttattgacttgacagtagaaagctcatcagatgaggaggac
ctgcccccgacgaagaagcactgtcctgtcacgtcagctgccatcccggctcttcctgga
agcaaaggagtcctgacatctggtcaccagccatcttcggtgctgcggagccctgctatg
ggcacgctgggcggggatttcctgtccagtctcccactacatgagtacccgcccgccttc
cccctcggggctgatatccaaggtttagatttattttcttttcttcagactgagagtcag
cactatggtccctccgtcatcacctcactagatgaacaggatgccctgggccacttcttc
cagtaccgagggaccccttcccacttcctgggcccgctcacccccacgttggggagctct
caccgcagcgccacgccggcaccccctcctggccgtgtcagtagcattgtggcccctgga
ggcaccttaagggagggccatggaggacccctgccctcaggtccctctttgactggctgt
cggtcagacatcatttccctggactga

DBGET integrated database retrieval system