KEGG   Bos mutus (wild yak): 102271875
Entry
102271875         CDS       T02919                                 

Gene name
ZFP36
Definition
(RefSeq) ZFP36 ring finger protein
  KO
K15308  tristetraprolin
Organism
bom  Bos mutus (wild yak)
Pathway
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102271875 (ZFP36)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102271875 (ZFP36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bom03019]
    102271875 (ZFP36)
Messenger RNA biogenesis [BR:bom03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102271875 (ZFP36)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Other DBs
NCBI-GeneID: 102271875
NCBI-ProteinID: XP_014332097
LinkDB
Position
Un
AA seq 365 aa
MVRSDYEHRDLEPNWAAGDQNPGYREEPGRPGRASSSRLPGSPPPPPLSLLSLSPELPSD
LGETESSTSWASSGPWSLSSSDSSLPEVAARLPGRSTSLVEGRSCGWVPPPPGFAPLAPR
PSSELSPSPTSPTATPTTSSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQASRHPKY
KTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPHVLRQSISFSGLPSGRRTSPPPAS
LAGPSVSSWSFSPSSSPPPPPGDLLLSPSAFSAAPGTPVSRRDPTPACCPSCRRATPNSV
WGPVGGLARSPSAHSLGSDPDEYASSGSSLGGSDSPVFEAGVFGPPQPPAAPRRLPIFNR
ISVSE
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggtgagatccgactacgagcacagggatttggagcccaactgggcggcgggcgaccaa
aaccctggttacagagaggaacccgggcgtccgggtcgagcctcctcgtcacggcttcca
ggaagcccccctcccccgccccttagcctcctgtcgctgagccctgaactgccatccgac
ctcggagagactgagtccagcaccagctgggcttcctcgggaccctggagcctcagctca
tccgactccagcctgcctgaggtcgctgcccgcctgcctggccgctccaccagcctggtg
gagggtcgcagctgcggctgggtgcccccacccccaggctttgcgcccctggctcctcga
cccagttcggagctgtcaccctcacccacctcgcctaccgccactcccaccacctcatcc
cgctacaagactgagctatgtcggaccttctcagaaagcgggcgctgccgctatggggcc
aagtgccagtttgctcatggcctgggtgagctgcgccaggccagtcgccaccccaagtat
aagacggagctctgccacaagttctacctccagggtcgctgcccctacggctcgcgctgc
cacttcatccacaaccccagcgaggacctggctgcccccggccatccccatgtgctgcgc
cagagcatcagcttctcagggctgccctccggccgccgaacctcgccaccaccagcaagc
ctagcaggcccttccgtgtcctcatggtccttctcgccctccagctccccaccaccacca
cccggggaccttctactttcaccctctgctttctctgctgccccagggacacctgtgtcc
cgaagggaccccaccccagcctgttgcccttcctgccgaagggccacccccaacagcgtc
tgggggcctgtgggtggcctagctcggagcccttctgcacactccctgggatctgatccc
gacgaatatgccagcagcggcagcagcctggggggatccgactcacctgtctttgaggct
ggggtttttgggccacctcagccacctgccgccccccggcgacttcccatcttcaatcgt
atctccgtttcggagtga

DBGET integrated database retrieval system