Bos mutus (wild yak): 102271913 Help Entry 102271913         CDS       T02919                                  Symbol CCL2 Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04062   Chemokine signaling pathway bom04621   NOD-like receptor signaling pathway bom04657   IL-17 signaling pathway bom04668   TNF signaling pathway bom04933   AGE-RAGE signaling pathway in diabetic complications bom05135   Yersinia infection bom05142   Chagas disease bom05144   Malaria bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05168   Herpes simplex virus 1 infection bom05171   Coronavirus disease - COVID-19 bom05323   Rheumatoid arthritis bom05417   Lipid and atherosclerosis bom05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102271913 (CCL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102271913 (CCL2)    04061 Viral protein interaction with cytokine and cytokine receptor     102271913 (CCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102271913 (CCL2)    04657 IL-17 signaling pathway     102271913 (CCL2)    04062 Chemokine signaling pathway     102271913 (CCL2)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102271913 (CCL2)    05164 Influenza A     102271913 (CCL2)    05168 Herpes simplex virus 1 infection     102271913 (CCL2)    05163 Human cytomegalovirus infection     102271913 (CCL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     102271913 (CCL2)   09174 Infectious disease: parasitic    05144 Malaria     102271913 (CCL2)    05142 Chagas disease     102271913 (CCL2)   09163 Immune disease    05323 Rheumatoid arthritis     102271913 (CCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102271913 (CCL2)    05418 Fluid shear stress and atherosclerosis     102271913 (CCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102271913 (CCL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102271913 (CCL2)    00536 Glycosaminoglycan binding proteins [BR:bom00536]     102271913 (CCL2) Cytokines and neuropeptides [BR:bom04052]  Cytokines   Chemokines    102271913 (CCL2) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Chemokines    102271913 (CCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 GPR15L DUF5480 CXCL16 Motif Other DBs NCBI-GeneID:  102271913 NCBI-ProteinID:  XP_005899757 LinkDB All DBs Position Un AA seq 99 aa AA seqDB search MKVSAALLCLLLTVAAFSTEVLAQPDAINSQVACCYTFNSKKISMQRLMNYRRVTSSKCP KEAVIFKTILGKELCADPKQKWVQDSINYLNKKNQTPKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgctgccctcctgtgcctgctactcacagtagctgccttcagcaccgag gtgcttgctcagccagatgcaattaactcccaagtcgcctgctgctatacattcaacagt aagaagatctcaatgcagaggctgatgaactacagaagagtcaccagcagcaagtgtccc aaagaggctgtgattttcaagaccatcctgggcaaggagttatgtgcagaccccaagcag aaatgggtccaggactccataaactatctcaacaagaaaaaccaaactccaaagccttga

DBGET integrated database retrieval system