KEGG   Bos mutus (wild yak): 102272421
Entry
102272421         CDS       T02919                                 
Symbol
MAPK10
Name
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04024  cAMP signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04137  Mitophagy - animal
bom04140  Autophagy - animal
bom04141  Protein processing in endoplasmic reticulum
bom04210  Apoptosis
bom04215  Apoptosis - multiple species
bom04217  Necroptosis
bom04310  Wnt signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04530  Tight junction
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04668  TNF signaling pathway
bom04722  Neurotrophin signaling pathway
bom04723  Retrograde endocannabinoid signaling
bom04728  Dopaminergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04910  Insulin signaling pathway
bom04912  GnRH signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04917  Prolactin signaling pathway
bom04920  Adipocytokine signaling pathway
bom04926  Relaxin signaling pathway
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04936  Alcoholic liver disease
bom05010  Alzheimer disease
bom05012  Parkinson disease
bom05016  Huntington disease
bom05017  Spinocerebellar ataxia
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05133  Pertussis
bom05135  Yersinia infection
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05208  Chemical carcinogenesis - reactive oxygen species
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05231  Choline metabolism in cancer
bom05415  Diabetic cardiomyopathy
bom05417  Lipid and atherosclerosis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102272421 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102272421 (MAPK10)
   04012 ErbB signaling pathway
    102272421 (MAPK10)
   04014 Ras signaling pathway
    102272421 (MAPK10)
   04310 Wnt signaling pathway
    102272421 (MAPK10)
   04668 TNF signaling pathway
    102272421 (MAPK10)
   04068 FoxO signaling pathway
    102272421 (MAPK10)
   04071 Sphingolipid signaling pathway
    102272421 (MAPK10)
   04024 cAMP signaling pathway
    102272421 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102272421 (MAPK10)
   04137 Mitophagy - animal
    102272421 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    102272421 (MAPK10)
   04215 Apoptosis - multiple species
    102272421 (MAPK10)
   04217 Necroptosis
    102272421 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102272421 (MAPK10)
   04530 Tight junction
    102272421 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102272421 (MAPK10)
   04621 NOD-like receptor signaling pathway
    102272421 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    102272421 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    102272421 (MAPK10)
   04660 T cell receptor signaling pathway
    102272421 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    102272421 (MAPK10)
   04659 Th17 cell differentiation
    102272421 (MAPK10)
   04657 IL-17 signaling pathway
    102272421 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    102272421 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102272421 (MAPK10)
   04920 Adipocytokine signaling pathway
    102272421 (MAPK10)
   04912 GnRH signaling pathway
    102272421 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    102272421 (MAPK10)
   04917 Prolactin signaling pathway
    102272421 (MAPK10)
   04926 Relaxin signaling pathway
    102272421 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    102272421 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    102272421 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    102272421 (MAPK10)
   04722 Neurotrophin signaling pathway
    102272421 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102272421 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102272421 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272421 (MAPK10)
   05208 Chemical carcinogenesis - reactive oxygen species
    102272421 (MAPK10)
   05231 Choline metabolism in cancer
    102272421 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102272421 (MAPK10)
   05212 Pancreatic cancer
    102272421 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102272421 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    102272421 (MAPK10)
   05161 Hepatitis B
    102272421 (MAPK10)
   05171 Coronavirus disease - COVID-19
    102272421 (MAPK10)
   05162 Measles
    102272421 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102272421 (MAPK10)
   05169 Epstein-Barr virus infection
    102272421 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102272421 (MAPK10)
   05135 Yersinia infection
    102272421 (MAPK10)
   05133 Pertussis
    102272421 (MAPK10)
   05152 Tuberculosis
    102272421 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102272421 (MAPK10)
   05142 Chagas disease
    102272421 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102272421 (MAPK10)
   05012 Parkinson disease
    102272421 (MAPK10)
   05016 Huntington disease
    102272421 (MAPK10)
   05017 Spinocerebellar ataxia
    102272421 (MAPK10)
   05020 Prion disease
    102272421 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    102272421 (MAPK10)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102272421 (MAPK10)
   05418 Fluid shear stress and atherosclerosis
    102272421 (MAPK10)
   05415 Diabetic cardiomyopathy
    102272421 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102272421 (MAPK10)
   04936 Alcoholic liver disease
    102272421 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    102272421 (MAPK10)
   04931 Insulin resistance
    102272421 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102272421 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102272421 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102272421 (MAPK10)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102272421 (MAPK10)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102272421 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 RIO1 Kinase-like APH Haspin_kinase FTA2
Other DBs
NCBI-GeneID: 102272421
NCBI-ProteinID: XP_014337672
LinkDB
Position
Un
AA seq 229 aa
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRD
NT seq 690 nt   +upstreamnt  +downstreamnt
atgagcaaaagcaaagttgacaaccagttctatagcgtggaagtgggagactcaacgttc
acggttctcaaacgctaccagaatctaaagcctattggctctggggctcagggaatagtc
tgcgctgcgtatgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccc
tttcagaaccaaacgcatgccaagagagcctaccgggagctggtcctcatgaagtgtgtg
aatcataaaaacattattagtttattaaatgtcttcacaccccagaaaacactggaggag
ttccaagatgtttacttagtcatggagctgatggatgctaacttgtgtcaggtgattcag
atggagttagaccacgagcgaatgtcttacctgctctaccaaatgttgtgtggcatcaag
caccttcactctgctgggattattcacagggacttaaaaccaagtaacattgtagtcaag
tctgattgtacattgaaaatcctagactttgggctggccagaacagcaggcacaagcttc
atgatgactccctatgtggtaacacgttattaccgggcccccgaggtcattctgggaatg
ggctacaaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgc
cacaaaatcctgtttccaggaagggactaa

DBGET integrated database retrieval system