KEGG   Bos mutus (wild yak): 102272426
Entry
102272426         CDS       T02919                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04151  PI3K-Akt signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  Jak-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04672  Intestinal immune network for IgA production
bom04940  Type I diabetes mellitus
bom05135  Yersinia infection
bom05142  Chagas disease (American trypanosomiasis)
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05320  Autoimmune thyroid disease
bom05321  Inflammatory bowel disease (IBD)
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102272426 (IL2)
   04151 PI3K-Akt signaling pathway
    102272426 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102272426 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102272426 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102272426 (IL2)
   04660 T cell receptor signaling pathway
    102272426 (IL2)
   04658 Th1 and Th2 cell differentiation
    102272426 (IL2)
   04659 Th17 cell differentiation
    102272426 (IL2)
   04672 Intestinal immune network for IgA production
    102272426 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272426 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102272426 (IL2)
   05321 Inflammatory bowel disease (IBD)
    102272426 (IL2)
   05330 Allograft rejection
    102272426 (IL2)
   05332 Graft-versus-host disease
    102272426 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102272426 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102272426 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102272426 (IL2)
   05162 Measles
    102272426 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    102272426 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272426 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102272426 (IL2)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102272426 (IL2)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Haparin
  Cytokines
   102272426 (IL2)
SSDB
Motif
Pfam: IL2 DUF922
Other DBs
NCBI-GeneID: 102272426
NCBI-ProteinID: XP_005908401
UniProt: L8HS84
LinkDB
Position
Un
AA seq 155 aa
MYKIQLLSCIALTLALVANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH
TFDFYVPKVNATELKHLKCLLEELKLLEEVLNLAPSKNLNPREIKDSMDNIKRIVLELQG
SETRFTCEYDDATVNAVEFLNKWITFCQSIYSTMT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaagatacaactcttgtcttgcattgcactaactcttgcactcgttgcaaacggt
gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctggat
ttacagttgcttttggagaaagttaaaaatcctgagaacctcaagctctccaggatgcat
acatttgacttttacgtgcccaaggttaacgctacagaattgaaacatcttaagtgttta
ctagaagaactcaaacttctagaggaagtgctaaatttagctccaagcaaaaacctgaac
cccagagagatcaaggattcaatggacaatatcaagagaatcgttttggaactacaggga
tctgaaacaagattcacatgtgaatatgatgatgcaacagtaaacgctgtagaatttctg
aacaaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system