KEGG   Bos mutus (wild yak): 102272565
Entry
102272565         CDS       T02919                                 

Gene name
AOX1
Definition
(RefSeq) aldehyde oxidase 1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00280  Valine, leucine and isoleucine degradation
bom00350  Tyrosine metabolism
bom00380  Tryptophan metabolism
bom00750  Vitamin B6 metabolism
bom00760  Nicotinate and nicotinamide metabolism
bom00830  Retinol metabolism
bom00982  Drug metabolism - cytochrome P450
bom01100  Metabolic pathways
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102272565 (AOX1)
   00350 Tyrosine metabolism
    102272565 (AOX1)
   00380 Tryptophan metabolism
    102272565 (AOX1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    102272565 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    102272565 (AOX1)
   00830 Retinol metabolism
    102272565 (AOX1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102272565 (AOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272565 (AOX1)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     102272565 (AOX1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 102272565
NCBI-ProteinID: XP_005895091
LinkDB
Position
Un
AA seq 1339 aa
MEGGAELLFYVNGRKVTEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKKIRHYPANACLTPICSLYGAAVTTVEGIGSTKTRIHPVQERIAKCHGTQCGFCTPG
MVMSLYTLLRNHPEPTLTQLNDALGGNLCRCTGYRPIINACKTFCKTSGCCQSKENGVCC
LDQGINGLPEFEEGNETSLKLFSEEEFLPLDPTQELIFPPELMTMAEKKTQKTRIFGSDR
MTWISPVTLKELLEAKVKYPQAPVVMGNTSVGPDMKFKGIFHPVIISPDRIEELSVVNYT
DNGLTLGAAVSLAEVKDILANVTRKLPEEKTQMYHALLKHLETLAGPQIRNMASLGGHIV
SRHPDSDLNPLLAVGNCTLNLLSKEGRRQIPLNEQFLRKCPSADLKPEEILISVNIPYSK
KWEFVSAFRQAQRQQNALAIVNSGMRVCFGKGDGIIRELSIAYGGVGPTTILANNSCQKL
IGRPWNEEMLDAACRLILDEVSLPGSAPGGRVEFKRTLIVSFLFKFYLEVSQILKGMDPV
HYPGLASKYESALEDLHSRHYWSTLKYQNADLKQLSQDPIGHPIMHLSGIKHATGEAIYC
DDMPVVDRELFLTFVTSSRAHAKIVSIDVSAALSLPGVVDILTGEHLPGINTTFGFLTDA
DQLLSTDEVSCVGQLVCAVIADSEVQAKRAAQQVKIVYQDLEPVILTIEEAIQNKSFFEP
ERKLEYGNVDEAFKMVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDREIDVYVSAQFPK
YIQDITASVLKVSANKVMCHVKRVGGAFGGKVTKTGVLAAITAFAANKHGRPVRCILERG
EDILITGGRHPYLGKYKAGFMNDGRILALDMEHYNNAGAFLDESLFVIEMGLLKLENAYK
FPNLRCRGWACRTNLPSNTALRGFGFPQAGLITEACITEVAAKCGLPPEKVRMINMYKEI
DQTPYKQEINTKNLTQCWKECMATSSYTLRKAAVEKFNSENYWKKKGLAMVPLKYPIGLG
SVAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVASRELRMPLSSIHLRGTSTET
IPNTNPSGGSVVADLNGLAVKDACQTLLKRLKPIISKNPKGTWKDWAQAAFNESISLSAT
GYFRGYESNINWETGEGHPFEYFVYGAACSEVEIDCLTGAHKNIRTDIVMDVGYSINPAL
DVGQIEGAFIQGMGLYTIEELNYSPQGVLYTRGPNQYKIPAICDIPMELHISFLPPSENS
NTLYSSKGLGESGVFLGCSVFFAIHDAIRAARQERGLPGPLRLNSPLTPEKIRMACEDKF
TKMIPRDEPGSYVPWSVPI
NT seq 4020 nt   +upstreamnt  +downstreamnt
atggaagggggcgccgagctgctcttctacgtgaacggccgcaaggtgacagaaaaaaat
gttgatcctgaaacaatgctattgccatatctgaggaagaagctccgactcacaggaact
aaatatggctgtggagggggaggctgtggtgcctgcacagtgatgatatcacgatataac
cccattaccaagaagataagacattatccagccaacgcctgtctgacgcccatctgttct
ctgtatggggctgccgtcaccacagtagaaggcataggaagcaccaagaccaggattcat
cctgttcaggagaggattgccaagtgtcacggcacgcagtgcggcttctgcacccccggg
atggtgatgtccctgtacacgctgctgaggaaccatccggagcccaccctgactcagcta
aatgatgctcttggtggtaacctgtgtcgttgcactggatacaggcccataatcaatgca
tgcaagactttctgtaaaacttctggctgctgtcaaagtaaagaaaatggggtttgctgt
ttggatcaaggaataaatggattaccagaatttgaggaaggaaatgagacaagtctgaaa
ctcttctcagaagaggagtttctgccattggatccaactcaagagctgatatttcctccc
gagctaatgacaatggctgagaaaaaaacacagaagaccaggatttttggtagtgataga
atgacctggatttccccagtgaccctgaaggaacttctagaagccaaagtcaagtatccc
caggcccctgttgtcatggggaacacctctgtgggccctgacatgaaatttaaaggcatc
tttcacccagttataatttctcctgatagaattgaagaactgagtgttgtaaactataca
gataacgggctgaccttaggtgccgctgtcagccttgctgaggtgaaagacatcctggct
aatgtgacccggaaactccctgaggagaagacacagatgtaccatgctctcctgaaacat
ttggaaactctggctgggccccagatcaggaatatggcttctttagggggccacatagtg
agcaggcatccagattcagatctgaaccctctcctggctgtgggcaactgtaccctcaac
ctgctgtcaaaagaaggaagacgacagattcctttaaatgagcagtttctcagaaagtgc
ccaagtgccgatcttaagcctgaagaaatcttgatctcagtgaacatcccctattcaaag
aagtgggagtttgtgtcagccttccgacaagcccagcggcaacagaatgcgcttgcaata
gttaattcgggaatgagagtgtgttttggaaaaggagatggcatcatcagagagttatcc
attgcatacggaggcgttggtccaaccaccatccttgcaaataattcctgccagaaactc
attggaaggccctggaatgaagagatgctggatgcagcttgcaggctgattctggatgaa
gtctccctcccaggctcagccccaggtgggagggtggagttcaagaggaccctcattgtc
agcttcctgttcaagttctacctggaagtgtcacagattttgaaggggatggaccctgtt
cactatcctggccttgcaagcaagtatgagagtgctttagaagatcttcattccagacat
tactggagtacattaaagtaccagaatgcagacctaaagcagctttctcaagacccaatt
ggccatcccatcatgcacctgtctggtattaagcatgccacgggcgaagccatctactgt
gatgacatgcctgtggtggaccgggaactgttcttgacttttgtaacaagttcaagagct
catgctaagattgtgtctatcgatgtctctgcagctctcagcctgcctggggtggtagac
atcctgactggggaacatcttccaggcatcaacaccacctttggctttttaactgacgct
gatcaacttctgtcaacagatgaggtgtcttgtgtgggtcagcttgtctgcgccgtgata
gccgattccgaggtccaggcaaagcgagctgctcagcaagtgaagattgtctaccaagat
ttggagccagtgatcctaaccattgaggaagctatacaaaacaagtccttctttgagcca
gagaggaaactggagtatggaaatgtggatgaagcatttaaaatggtggatcaaattctt
gaaggtgaaatacacatgggaggtcaagaacacttttatatggaaacccagagcatgctg
gttgttcccaaaggagaagatcgagaaatcgatgtctacgtgtctgctcagtttcctaaa
tacatacaggacataactgcttcagtcttgaaggtctcagctaacaaagtcatgtgtcac
gtaaagcgtgttggtggagcctttgggggaaaggtgacaaaaactggcgtcctggcagcc
atcaccgcatttgctgcaaacaagcatggtcgtccagtccgctgcattctggaacgagga
gaagacatattaataactggaggccgccacccttaccttggaaagtataaagctggattc
atgaatgatggcagaatcttggctctggatatggagcattataacaatgcaggtgccttc
ctggatgagtcattatttgtaatagagatgggacttctgaaactggaaaatgcctacaag
tttcccaacctgcgctgccgggggtgggcgtgcagaaccaaccttccatccaacacagct
ttgcgagggtttggctttccccaggcagggctgatcactgaagcctgtatcacagaagtg
gcagccaaatgtgggttgccccctgagaaggtccgaatgataaacatgtataaggaaatt
gatcaaacaccctacaaacaggagattaataccaagaacctgacccagtgttggaaagaa
tgcatggccacgtcttcctacaccctaaggaaagcagcggtggagaaattcaactcggag
aattactggaagaagaaggggctggcaatggtccccctgaagtatcctattggccttgga
tcagttgctgctggtcaggctgctgccctggttcacatttatctggatgggtctgtgctg
gtgactcacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggcg
agtcgtgagttaaggatgccactgtccagtatccacctccggggaacaagcacagaaacc
atccctaatacaaatccctctggaggttccgtagtggctgatctcaacgggttggcagta
aaggatgcttgtcagactcttctgaaacgccttaaacccatcatcagcaagaatcccaaa
ggcacttggaaagattgggcacaggctgcctttaatgaaagcattagtctctcagctact
ggatacttcaggggttatgagtcgaacataaactgggagacaggcgaaggccaccctttc
gaatactttgtttatggagcagcctgttccgaggttgagatagactgcctgacaggtgct
cataagaacatcagaacagacattgtcatggatgttggctacagtataaatccagccctt
gacgtaggccagattgaaggtgcgtttattcaaggcatgggactttatacaatagaggaa
ctgaattattctcctcaaggtgtcctgtacacccggggcccgaaccagtataaaatccct
gccatctgtgacatccccatggagctgcacatttcttttttgcctccctctgaaaactcg
aataccctgtattcgtctaagggtctgggagagtctggggtattcctggggtgctcagtg
tttttcgccatccacgatgcaataagggcagcacgacaggagagaggcctgcctggacca
ctgaggctcaacagcccactgactccagagaagattagaatggcctgtgaagacaagttc
acaaaaatgattccaagagatgaacctggatcgtatgttccttggagtgtacccatatga

KEGG   Bos mutus (wild yak): 102281032
Entry
102281032         CDS       T02919                                 

Definition
(RefSeq) aldehyde oxidase 4-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00280  Valine, leucine and isoleucine degradation
bom00350  Tyrosine metabolism
bom00380  Tryptophan metabolism
bom00750  Vitamin B6 metabolism
bom00760  Nicotinate and nicotinamide metabolism
bom00830  Retinol metabolism
bom00982  Drug metabolism - cytochrome P450
bom01100  Metabolic pathways
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102281032
   00350 Tyrosine metabolism
    102281032
   00380 Tryptophan metabolism
    102281032
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    102281032
   00760 Nicotinate and nicotinamide metabolism
    102281032
   00830 Retinol metabolism
    102281032
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102281032
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102281032
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     102281032
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Fer2_2 Ald_Xan_dh_C Fer2
Other DBs
NCBI-GeneID: 102281032
NCBI-ProteinID: XP_014338449
LinkDB
Position
Un
AA seq 1335 aa
MPSLSNSDELIFFVNGRKVIEKNADPEVYLLFYLRKILHLTGTKYSCGSGGCGACTVMVS
RYDPKTKKIHHYPVTACLVPICSLHGAAVTTVEGVGSMKTRLHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPTPEQITEALGGNLCRCTGYRPIVESGKTFCAESTVCQMKGSG
KCCMDQEEKSFTSRQEKMCTKLYNEDEFQPFDPTQEPVFPPELIRMAEDPNKRRLTFRGK
RTTWITPVNLNDLLELKTSFPEAPIIMGNTAVGPSIKFRDEFHPVFISPLGLQELYFVDS
TDDGVTIGAGYSLAQLNDALHFIVSEQPKEKTKTYHALLKHLRTLAGAQIRNMATLGGHV
VSRPNYSDLNPILAAGNATINLISKEGKRQIPLDGRFLEKSPEANLKSEETVLSVYILHS
TQWHFVSGLRIAQRQENAFAIVNAGMSVKFEDGTDTIKELQMFYGSVGPTVVSASKTCQQ
LIGRKWNDQMLSDACRLVLDEIYIPPDAEGGMVEYRRTLIISLLFKFYLKVRRGLNKMDP
HKFPDIPEKFVSALEDFPIETPQGIQMFQCVDPHQPPQDPVGHPVMHQSAIKHTTGEAVF
VDDMPPISQELFLAVVTSTRAHAKIILIDTSAALALPGVVDVITAEDVPGDNSYQGEIFY
AQNEVICVGQIVCTVAADTYAHAKEAAKKVRIVYEDLEPRIITIEQALEHNSFLSAEKKI
EQGDVEQAFKYVDQIIEGKVHVEGQEHFYMETQTILAIPQEEDKEMVLHLGTQFQTHVQE
YVAAALNIPRNRITCHTKRAGGAFGGKVSKPALLGAVSAVAAKKTGRPIRFILERGDDML
ITAGRHPLLGKYKIGFMNNGVIKAADIEYYINGGCSPDESELVMEFMVLRSENAYYIPNF
RCRGRPCKTNLPSNTAFRGFGFPQGIVVGEAYITAVASQCDLTPEQVKEINMYKRTSRTA
HKQTFNPEPLRRCWKECLEKSSFSARKLAAEEFNKKNSWKKRGXAAVPMKFTVGMPTAYY
PQAAALVHIYLDGSVLVSHSGCELGQGLHTKMIQVASRELNIPESYIHLSETNTTTVSNA
TFTAGSMGADINGKAVQNACQILKARLEPVIRKNPRGTWEAWISEAYKESISLSTTGYFK
GYQTNMDWKKGEGNAFPYFVYGASCSEVEVDCLTGAHKLLRTDIFMDAAFSINPAVDIGQ
IEGAFVQGMGFYTIEELKYSPEGVLYSRGPDDYKIPTVTEIPEEFNVTLVRSQNPIAIYS
SKGLGEAGMFLGSSVLFAIYDAVAAARRERGLTKTFTLSSPATPELIRMTCVDQFTDMIP
RDDPSTFTPWSIHVS
NT seq 4008 nt   +upstreamnt  +downstreamnt
atgccttctctttccaattctgatgagttgattttttttgtgaatggaagaaaggtcata
gagaagaatgctgatcctgaagtatatctactattctacttgaggaaaatcctccacctc
accggcaccaaatacagctgtgggagcggaggctgcggtgcctgcactgtcatggtgtcc
agatacgacccaaagaccaagaagatccaccattatccagttacagcgtgcctggtgccc
atctgctctctgcatggggctgctgtcaccactgtggaaggtgtaggaagcatgaaaacc
aggcttcaccccgtgcaggaaagacttgccaagtgtcatgggacacagtgtggcttctgc
agcccaggaatggtgatgtccatctacacgctgctgaggaaccacccggagcccacccct
gagcagataaccgaagctcttggaggtaatttgtgccgctgtactggataccgaccaatt
gtagaaagtggaaaaactttctgtgcggaatcaactgtttgtcaaatgaaaggatcagga
aaatgttgcatggatcaagaagagaagtctttcacaagtagacaggaaaaaatgtgtacc
aagctgtacaacgaagatgaattccagcccttcgatccaacccaggaacctgtattccct
cctgaactgataagaatggcagaagacccgaacaaaaggaggctgacgttccgagggaag
aggaccacctggatcactcctgtaaacttgaatgaccttctggagctgaaaaccagtttc
cctgaagcccccatcatcatggggaacactgcagtgggacccagcattaaattcagagat
gaattccatccggtttttatatctccacttgggcttcaagaactatatttcgtggatagc
acagatgatggggtgacgataggcgcaggatacagcctggcccagttgaatgatgcctta
cattttattgtttctgaacaaccaaaggagaagaccaagacctaccacgctctcctgaag
cacctgagaacacttgctggagcccagattaggaatatggcgactttaggcgggcatgtg
gtgagcaggcctaactattctgacctgaatcccatcttagcagcaggaaatgctaccatc
aatctgatatctaaagaaggaaaacggcagattcctttagatggccgtttccttgagaag
tcacctgaagccaacctcaagtcagaagagactgtgttatctgtgtatattctgcactct
actcagtggcattttgtgtcaggactccggatagcccagcgtcaggagaacgcctttgcc
attgtcaatgctgggatgagcgtgaagtttgaggatggcacagacaccatcaaggaactt
cagatgttctacggaagtgttggccccactgttgtctctgcaagcaaaacctgccagcag
ctcattgggaggaaatggaacgaccagatgctgagtgatgcttgccgattggttctggat
gagatttacatccctccagacgctgaaggtggcatggtagagtataggcgaaccctcatc
atcagcttactcttcaaattctacctcaaagtgaggcgagggctgaacaaaatggacccc
cacaagtttcctgatatcccagaaaagttcgtgagtgcgctagaagatttccctatagaa
acaccccaaggcattcagatgttccagtgcgtggatccccaccaacccccacaagatcca
gttggccacccagtcatgcaccagtcagccattaaacacaccacaggggaagctgtgttt
gttgatgacatgccccccatctcccaagaactcttcctggctgtagtcaccagcaccaga
gctcatgcaaagataatattaattgatacttcagcagccctggcccttcctggtgttgtt
gatgtgataacagcagaggatgttccaggagataatagctatcagggagagattttctac
gcacaaaatgaggtaatttgcgtgggtcagatcgtctgcactgtggctgctgatacctat
gctcatgcaaaagaagctgctaaaaaagtgaggattgtttatgaagacctagagcccagg
attataacaatagagcaagccctagagcacaattcatttctttctgctgagaaaaaaatt
gagcaaggagatgtagagcaagcctttaaatatgttgaccaaatcattgaaggtaaggtc
catgtggaaggacaggaacacttttacatggaaacacaaactatcctggctatcccccaa
gaggaagataaagaaatggtgctacaccttgggacacagtttcagacccatgtgcaggaa
tatgtggctgcagcactaaacatcccaaggaacagaatcacctgtcacacgaaaagagct
ggaggagcattcggggggaaagtgagcaagcctgctctgctaggagctgtcagtgccgtg
gctgccaaaaagactggccgcccaatacggttcattctggaacgtggtgatgacatgttg
ataactgctggccgccacccactgctcggaaaatacaaaattggattcatgaacaatggt
gtgatcaaagctgctgatattgaatattatatcaatggcggatgcagtcctgatgagtct
gagttggtgatggagttcatggtgctgagaagtgaaaatgcatattatattcctaatttc
cggtgtcggggtagaccttgcaaaacaaatttgccatccaacactgctttccgaggattt
ggcttcccccagggcatagtggtcggtgaagcttatataactgctgtggcttctcagtgt
gacttaacccctgaacaggttaaagaaataaacatgtataagagaactagcagaacagcc
cataagcagacatttaatcctgagcccttgagaagatgctggaaagaatgtctggagaaa
tcttccttctctgctaggaaactggctgccgaggaatttaacaaaaagaactcctggaag
aagaggggcnttgctgcggtccccatgaaatttacagttgggatgcccacagcttattat
ccccaggctgctgctcttgtccacatctatctcgatggctccgtcttggtgagtcacagt
ggctgtgaactaggacaaggtcttcacaccaaaatgatccaggtggcaagtcgtgaactg
aacatccctgagtcgtatatacacctgtctgagacgaacactaccacggtttccaatgcg
accttcacagctggctcaatgggggcagacatcaacgggaaggctgtgcagaatgcctgc
caaattcttaaggcccgtcttgagccagtcatcaggaaaaaccccaggggaacgtgggag
gcgtggatttcagaagcctacaaagaatccatcagtctctccactactggatatttcaaa
ggctaccagacaaatatggactggaagaagggggaaggtaacgctttcccatattttgtt
tatggagcatcctgttccgaggttgaagtcgactgtctcacaggggctcataagctcctt
aggactgacatcttcatggatgctgctttcagcataaacccagctgtggacattggacag
attgaaggagcatttgtccaaggcatgggattctataccatagaagagctgaaatactct
ccagaaggcgtgctttactctcgaggtccagatgactacaaaatccccaccgtcactgaa
atacctgaagagttcaatgtcactttggtgcgttcccaaaatcccatcgccatctactcg
tccaaggggttaggtgaggctggaatgttcctgggatcctccgtgttgttcgccatatat
gatgccgtggctgctgcccgcagagagagggggctgaccaagactttcaccctgagtagc
ccagcaacccctgagttgattagaatgacttgtgtggatcagttcactgacatgattccc
agagatgatccatcaacatttacaccttggtccatccatgtgtcttaa

KEGG   Bos mutus (wild yak): 102283927
Entry
102283927         CDS       T02919                                 

Definition
(RefSeq) aldehyde oxidase 2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00280  Valine, leucine and isoleucine degradation
bom00350  Tyrosine metabolism
bom00380  Tryptophan metabolism
bom00750  Vitamin B6 metabolism
bom00760  Nicotinate and nicotinamide metabolism
bom00830  Retinol metabolism
bom00982  Drug metabolism - cytochrome P450
bom01100  Metabolic pathways
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102283927
   00350 Tyrosine metabolism
    102283927
   00380 Tryptophan metabolism
    102283927
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    102283927
   00760 Nicotinate and nicotinamide metabolism
    102283927
   00830 Retinol metabolism
    102283927
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102283927
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102283927
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     102283927
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 102283927
NCBI-ProteinID: XP_014338450
LinkDB
Position
Un
AA seq 1339 aa
MPCPSRSDELVFFVNGRKVIERNADPEVTLLSFLRKNLRLTGTKYACGRGGCGACTVMVS
KRDPTSQEIRHFSVTACLVPICSLYGAAVTTVEGVGSMKTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLLEALGGNLCRCAGYRPILASGKTFCLESNGCQQKGTG
KCCLDLGENDSSSLGRKSDICTELFVKEEFQPLDPTQELIFPPELLRMTENPEKRTLTFH
GERVTWISPGTFKDLLELKAKHPEAPLILGNTSLGPAMRSKGCLYPILPSPARISELNVV
SKTNDGLTIGAGCSLAQVKDILAERVSELPEEKTQTYRALLKHLKSLASQQIRNMASLGG
HIISRHSYSDLNPILAVGNATLNLTSEEGTRRIPLSEHFLAGLASADLKPEEILESVYIP
HSQKWEFVSAFRQAQCQQNALPDVNAGMRVLFKEGTDIIEDLSITYGGVGAATVSAHKSC
QQLLGRQWDELMLDEACRRLLDEVSLPGWAPGGRVEFKRTLVVSFFFKFYLQVLQELKKL
IKPRRYPEISDRFLSALEDFPGTVPQGVQRYQSVDSHQPLQDPVGRPVMHLSGLKHATGE
AEFCDDIPMVDKELCMALVTSTRAYAKIISVDLSEALEIPGVVDVITAKDIPGINGTKDD
KLLAVDEVLCVGQIICAVVAETDVQAKRAIEKIKITYEELEPIIFTIEDAIKHNSFLCPE
KKLEQGNIEEAFEKVDQIVEGEVHVGGQEHFYMETQRVLVIPKTEDKELDIYVSTQDPAH
VQKTVSSTLNIPINRITCHVKRVGGGFGGKIGRPAVFGAIAAVGALKTGHPIRLVLDRED
DMLITGGRHPLFGKYKVGFMNNGRIKALDIECFINGGCTLDDSELVTEFLILKLENAYKI
RNLRFRGRACLTNLPSNTAFRGFGFPQGTLVTESCITAVAAKCGLPPEKVREKNMYRTVD
KTIYKQAFNPESLIRCWNECLDVSSFHNRRKQAEEFNKKNYWKKRGVAVIPMKFSVGFAA
TSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELKIPMSHLHICETSTAMV
PNTIATAASVGADINGKAVQNACQILLKRLEPIIKKNPEGTWEEWIEAAFEQRISLSATG
YFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIVMDACCSLNPAID
IGQIEGAFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPTISDVPEEFNVSLLPSSQTPL
TIYSSKGLGESGMFLGSSVFFAITDAVAAARKERDIAEDFTVKSPATPEWVRMACADRFT
EMIPRDDPKTFKPWSITVA
NT seq 4020 nt   +upstreamnt  +downstreamnt
atgccttgcccgtcgagatcggatgagctggttttctttgtgaacgggaggaaggtgatt
gagaggaatgcagacccagaagtcactctcttgagcttcctaagaaagaacttgcgcctc
accggaaccaagtacgcctgcggaagaggaggctgcggtgcctgcaccgtgatggtgtct
aagcgagaccccacgtcccaggagataagacacttctctgtcaccgcctgcctggtgccc
atctgctctctgtatggggctgctgtcaccactgtggaaggtgttggaagcatgaaaacc
aggcttcaccccgtgcaggagaggattgccaagagccacggtacccagtgtggcttctgc
acccctgggatggtgatgtccatgtacacgctgctgaggaaccacccacagccctctgag
gagcaactgctggaagccctggggggtaacctgtgccgctgcgctgggtatcggccaatt
ctcgcaagcgggaagaccttttgtttggagtcaaatggctgtcaacagaaaggaacagga
aaatgctgcctggatctgggagaaaatgattcttcctcgcttggcaggaaaagtgacatt
tgcacagagttatttgtgaaagaggagttccagcccttggaccctacccaggagctcata
tttcccccggaactcttgagaatgacagagaacccagaaaaacgaaccctgacctttcac
ggagagagggttacttggatctcccctgggaccttcaaagacctcctggagctgaaagca
aaacacccagaagccccgctcatcctgggcaacacatcactgggacctgccatgagatct
aaaggatgtttgtacccaattctcccctctcctgctaggatttctgagctgaatgtggtg
tctaaaacaaatgatggactgacaataggtgctggctgcagtctggcccaggtcaaggac
atcttggctgagagggtctccgagctcccggaggagaagacccagacgtaccgagcgctg
ctgaagcacctgaagagtctggccagccagcagatccggaacatggcttctttagggggt
catattataagccgacatagctactcagatctgaacccaattctggctgtgggcaacgct
accctcaatctgacatcagaagaaggcacacggcggattcctctaagtgaacattttctt
gctgggttggcaagtgcagacctgaagccggaagaaattttggagtctgtgtatattcct
cactctcaaaagtgggaattcgtgtcagccttccgacaggctcagtgccagcaaaacgcc
ttgcccgacgtgaatgccggcatgcgagtcctcttcaaagagggcacagacatcatcgag
gacctgagcatcacctatggaggggtcggggctgccacagtcagtgcacataagtcctgc
cagcagctcctagggaggcagtgggatgagctgatgctggatgaagcttgcaggcggctc
ctggacgaagtctccctcccaggctgggctccaggtgggagggtggaattcaagaggact
ctggtagtcagcttcttcttcaagttctacctacaagttctgcaggaactgaagaagctc
ataaagccccgccgttatcctgaaatttcagaccgattcctgagcgctctagaagacttc
ccgggcacggttccccagggagtccaaaggtaccagagtgtggattctcaccagcccctc
caagatccagtcggacgccctgtcatgcacctatcgggtctcaaacacgccaccggggag
gccgagttttgtgatgacatccccatggtggataaagaactctgcatggctttagtgacc
agtaccagagcctatgcaaaaatcatatcagttgatttgtccgaggcccttgaaatacct
ggggtggttgatgtgataacagcgaaggacattccaggcatcaatggcaccaaagatgac
aaactgttggccgtagatgaggtactctgcgtgggccagatcatctgtgctgtggttgca
gaaacagatgtacaggcaaaacgtgctattgaaaagataaagataacttatgaagagctg
gagcccataatcttcaccatcgaggatgccataaaacacaactcattcctgtgccctgaa
aaaaaacttgaacaaggaaacatcgaggaggcatttgaaaaagttgatcaaattgttgaa
ggagaggtccatgtcggaggacaggagcatttttacatggaaacacagagagtgcttgtt
attccaaagacagaggacaaagaactggacatttatgtgtcaacacaggatccagcccac
gtgcagaaaacagtgtcctccactttaaacatccccatcaacaggatcacctgtcatgta
aagcgagtgggtggaggttttggcgggaagataggaagaccggctgtcttcggggctatt
gcagctgtgggtgctctcaaaactggtcatcccatccgtcttgttcttgatcgtgaagat
gatatgttaataactgggggaagacacccattatttggaaaatataaagtgggattcatg
aacaacgggcgaatcaaagctctagacatcgagtgcttcattaacggagggtgcacgttg
gatgactcagagctggtaacagaatttcttatcttgaagctggaaaatgcatataaaatc
cgcaacctcaggttccggggccgtgcatgcctgacaaatttaccatccaacacggccttt
cgaggatttggcttcccccaaggaaccctggtaacagaatcatgcatcacagctgtggca
gccaaatgtggccttccaccagaaaaggtaagggagaaaaacatgtaccgaacagttgat
aaaaccatctacaaacaagcgttcaaccctgagagcctgataaggtgttggaacgaatgt
ctggacgtgtcttcctttcacaacagaagaaagcaagcggaagagttcaataagaagaac
tactggaagaaaagaggcgttgcggtgattcccatgaaattttcagtcggctttgctgca
acaagctatcatcaggcagctgcgctggttcatatttacactgacgggtctgtattggtc
acacatggaggcaacgaactgggacaaggtattcacaccaaaatgctgcaggtggccagc
cgtgaattaaaaatacccatgtctcacttgcacatctgtgaaacaagtaccgccatggtg
cctaatacaatcgctacagcagcatctgtcggagcagatatcaatggcaaagccgtgcag
aatgcttgtcagatccttctgaaacgccttgagcccatcattaagaaaaatccagaaggt
acctgggaagaatggatagaagctgcttttgaacaaagaatcagtctttcagctactgga
tacttcaggggctacaaggccttcatggactgggagaagggagagggagaccctttcccc
tactatgtctatggagctgcctgttctgaggttgaaattgactgcctgacaggagctcac
aaaaaaatcagaacggacatcgtcatggatgcctgctgcagtctaaatccggccatcgat
attgggcagattgaaggtgcgtttattcagggaatgggcctttataccactgaagagctg
aaatattccccagaaggtgtcctgtactctcgaggcccagatgagtacaaaattccaacc
atcagcgatgtcccagaggaatttaatgtctccttgttgccatcatcacaaactccacta
accatctattcatccaagggcctgggagagtctgggatgttcctggggtcatccgtgttc
tttgccatcactgatgctgtggctgcagctcgcaaagaaagagacatagctgaggatttc
acagtgaagagcccagcgactccagaatgggttcgaatggcctgtgcagatcggttcaca
gaaatgatcccaagagatgatcctaagacatttaaaccctggtctatcaccgtagcataa

DBGET integrated database retrieval system