KEGG   Bos mutus (wild yak): 102272962
Entry
102272962         CDS       T02919                                 

Gene name
MAP2K6
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04015  Rap1 signaling pathway
bom04218  Cellular senescence
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04668  TNF signaling pathway
bom04750  Inflammatory mediator regulation of TRP channels
bom04912  GnRH signaling pathway
bom04935  Growth hormone synthesis, secretion and action
bom05014  Amyotrophic lateral sclerosis
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05135  Yersinia infection
bom05145  Toxoplasmosis
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102272962 (MAP2K6)
   04015 Rap1 signaling pathway
    102272962 (MAP2K6)
   04668 TNF signaling pathway
    102272962 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102272962 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102272962 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    102272962 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102272962 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    102272962 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102272962 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102272962 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102272962 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102272962 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    102272962 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102272962 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102272962 (MAP2K6)
   05135 Yersinia infection
    102272962 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102272962 (MAP2K6)
   05161 Hepatitis B
    102272962 (MAP2K6)
   05163 Human cytomegalovirus infection
    102272962 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102272962 (MAP2K6)
   05169 Epstein-Barr virus infection
    102272962 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102272962 (MAP2K6)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102272962 (MAP2K6)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: STE group
  STE7 family
   102272962 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal DUF4344 Choline_kinase APH
Other DBs
NCBI-GeneID: 102272962
NCBI-ProteinID: XP_005899379
LinkDB
Position
Un
AA seq 329 aa
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELG
RGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHFLNPKRQTWHLL
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccctggccttaaaattcccaaagaagcattt
gaacaacctcagaccagttccacgccaccgcgggatttagactccaaagcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgacctggagcccatcgtggagctgggc
cggggggcgtacggggtggtggagaagatgcggcatgtgcccagcgagcagatcatggcg
gtgaagcggatccgggccacggtaaacagccaagagcagaagcggctcctgatggatctg
gatatctccatgaggaccgtggactgtcccttcacggtcaccttttacggcgcactcttc
cgtgagggggatgtctggatctgcatggagctcatggacacgtccctagataaattctac
aaacaagtgatcgataaaggccaaacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagccttagagcatttgcacagtaagctgtctgtcattcaccgagatgtc
aagccctccaacgtgctcatcaacgctctgggccaggtgaagatgtgcgacttcggaatc
agcggctacctggtcgactccgtggctaaaaccatcgatgccggatgcaaaccgtacatg
gcccccgagagaataaacccagagctcaaccagaagggatacagcgtgaagtccgacatc
tggagtttgggcatcaccatgatcgagctggccatcctccggtttccctacgactcatgg
gggactcctttccagcagctcaaacaggtggtggaggagccttcgccgcagctgcccgca
gacaagttctccgaagagtttgttgactttacctcacagtgcttgaagaagaattccaaa
gaaaggccaacatatccagagcttatgcaacatccgtttttcaccctacattttttgaat
ccaaagcgacagacgtggcatcttttgtaa

DBGET integrated database retrieval system