KEGG   Bos mutus (wild yak): 102272969Help
Entry
102272969         CDS       T02919                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00010  Glycolysis / Gluconeogenesis
bom00053  Ascorbate and aldarate metabolism
bom00071  Fatty acid degradation
bom00280  Valine, leucine and isoleucine degradation
bom00310  Lysine degradation
bom00330  Arginine and proline metabolism
bom00340  Histidine metabolism
bom00380  Tryptophan metabolism
bom00410  beta-Alanine metabolism
bom00561  Glycerolipid metabolism
bom00620  Pyruvate metabolism
bom01100  Metabolic pathways
Module
bom_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102272969 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102272969 (ALDH2)
   00620 Pyruvate metabolism
    102272969 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102272969 (ALDH2)
   00561 Glycerolipid metabolism
    102272969 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102272969 (ALDH2)
   00310 Lysine degradation
    102272969 (ALDH2)
   00330 Arginine and proline metabolism
    102272969 (ALDH2)
   00340 Histidine metabolism
    102272969 (ALDH2)
   00380 Tryptophan metabolism
    102272969 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102272969 (ALDH2)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102272969 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 102272969
NCBI-ProteinID: XP_005902645
LinkDB All DBs
Position
Un
AA seq 419 aa AA seqDB search
MDASERGRLLADLIERDRTYLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHG
KTIPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTA
LYVANLIKEAGFPPGVVNVIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSN
LKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVER
SVARAKSRVVGNPFDSRTEQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFI
QPTVFGDVQDGMTIAKEEIFGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANY
LSQALQAGTVWVNCYDVFGAQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVRVPQKNS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgtccgagaggggccggctgctggctgatctgattgagcgagaccggacctac
ttggcagccttggagaccctggacaacggcaagccctatatcatctcctacctggtggat
ctggacatggtcctcaagtgcctgcgttactatgccggctgggctgacaaataccatggg
aaaaccattcccattgacggggactacttcagctacacccgccatgaacctgtgggagtg
tgtgggcagatcatcccatggaacttcccgctcctgatgcaagcctggaaactgggccca
gccttggcgacgggaaacgtggttgtgatgaaggtggctgagcagactccactcactgcc
ctctatgtggccaacctgattaaggaggctggctttcctccgggtgtggtcaatgttatt
cctggatttggccccacggccggagctgccatcgcctcccatgaggacgtggacaaagtg
gctttcaccggctccactgaggttggccacctaatccaggttgctgcggggaagagtaac
ctcaagagagtgaccctggagctaggaggaaagagtcccaatatcatcatgtcagatgct
gatatggactgggctgtggagcaggcccacttcgccctgttcttcaaccagggccagtgc
tgctgtgcaggctcgcggacctttgtgcaggaggacatttacgccgagtttgtggaacgg
agcgttgcccgggccaagtctcgtgtggttgggaacccctttgacagccggactgagcag
gggccgcaggtggatgaaacgcagtttaagaaggtccttggctatatcaaatctgggaag
gaggagggggcgaagctgctgtgtggtggaggggcggctgctgaccgtggctacttcatc
cagcccactgtgtttggagacgtgcaagatggcatgaccatcgcaaaggaggagatcttt
gggccagtgatgcagattctgaagttcaagagcatggaggaagtcgtcgggagagccaac
aattccaagtacgggctggctgcagctgtcttcacgaaggacttggacaaggccaattac
ctgtcccaggccctccaggccggcactgtgtgggtcaactgctatgacgtgtttggggcc
cagtcgccgttcggtggctacaagctgtctgggagtggccgggagctgggggaatacggg
ctgcaggcgtacaccgaagtgaagaccgtcacagtcagagttcctcagaagaactcctaa

DBGET integrated database retrieval system