KEGG   Bos mutus (wild yak): 102273045
Entry
102273045         CDS       T02919                                 

Gene name
TRADD
Definition
(RefSeq) TNFRSF1A associated via death domain
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04064  NF-kappa B signaling pathway
bom04071  Sphingolipid signaling pathway
bom04210  Apoptosis
bom04217  Necroptosis
bom04622  RIG-I-like receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04668  TNF signaling pathway
bom04920  Adipocytokine signaling pathway
bom05132  Salmonella infection
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102273045 (TRADD)
   04064 NF-kappa B signaling pathway
    102273045 (TRADD)
   04668 TNF signaling pathway
    102273045 (TRADD)
   04071 Sphingolipid signaling pathway
    102273045 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102273045 (TRADD)
   04217 Necroptosis
    102273045 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102273045 (TRADD)
   04657 IL-17 signaling pathway
    102273045 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102273045 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102273045 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102273045 (TRADD)
   05152 Tuberculosis
    102273045 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102273045 (TRADD)
   05160 Hepatitis C
    102273045 (TRADD)
   05164 Influenza A
    102273045 (TRADD)
   05162 Measles
    102273045 (TRADD)
   05168 Herpes simplex virus 1 infection
    102273045 (TRADD)
   05163 Human cytomegalovirus infection
    102273045 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102273045 (TRADD)
   05169 Epstein-Barr virus infection
    102273045 (TRADD)
   05165 Human papillomavirus infection
    102273045 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death TPR_14
Other DBs
NCBI-GeneID: 102273045
NCBI-ProteinID: XP_005896623
UniProt: A0A6B0R3G4
LinkDB
Position
Un
AA seq 312 aa
MAAGPNGLEEWVGSAYLFVESSLDKVVLSDAYAHQQQKVAMYGALQTALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFSGRQACSRFLRAYREGALRATLQGCLARALALNSVPLQLELRA
GAEQLDALLTNEERCLNCICAQKPDRLRDEELTELENALRNLTCGSAGGQGSDVQGTPAP
LQSLAPSPPEEKPPPPLPGQTFLFQGQPIVNRPLNLQDQQKFARSVGLKWRKVGRSLQRS
CRALRDPALDSLAYEYERDGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLANPDSSLA
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcggctgggccaaatgggcttgaggagtgggtgggcagcgcatacctgtttgtggag
tcctcactggacaaagtggtcttgtccgatgcctacgctcaccagcagcagaaagtggca
atgtacggggctctccagactgccctagcagagagtggcgggagccccgacgtgctgcag
atgctcaagatccaccgcagcgatccgcagctgatcgtgcaactgcgtttcagcgggcgc
caggcgtgcagccgcttcctccgcgcctaccgcgagggggcgctaagagccacgctgcaa
gggtgcctggctcgggcactggccctgaactcggtgccactgcaactggagctgcgcgct
ggcgccgagcagctggatgccttgctgaccaacgaggagcgctgtttgaactgcatatgc
gcccagaagcctgaccggctccgggatgaggaactcaccgagttggagaatgcgctcagg
aatctgacgtgcggttcggcggggggccaaggaagcgacgtgcaaggcactccagccccc
ttgcagtctctggcaccttctccgccggaggagaaaccgccaccaccgctgcctggccaa
acttttttgttccagggtcagcccatagtgaaccggccgttgaacctgcaggatcaacag
aagttcgcccgctcagtgggcctcaagtggcgcaaggtggggcgctctctgcagcgcagc
tgccgcgcgctgcgggacccggcgctggactcactggcctatgaatacgagcgcgacggg
ctgtacgagcaggccttccagctgctgcggcgctttgtgcaggccgagggccgccgcgcc
acgctgcagcgcctggtggaggcgctcgaggagaacgagctcaccagcctggcggaggac
ttgctgggcctggcgaatcctgacagcagcctggcctag

DBGET integrated database retrieval system