KEGG   Bos mutus (wild yak): 102273253
Entry
102273253         CDS       T02919                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04071  Sphingolipid signaling pathway
bom04145  Phagosome
bom04151  PI3K-Akt signaling pathway
bom04310  Wnt signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04520  Adherens junction
bom04530  Tight junction
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04810  Regulation of actin cytoskeleton
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04972  Pancreatic secretion
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05100  Bacterial invasion of epithelial cells
bom05132  Salmonella infection
bom05135  Yersinia infection
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05231  Choline metabolism in cancer
bom05416  Viral myocarditis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102273253 (RAC1)
   04014 Ras signaling pathway
    102273253 (RAC1)
   04015 Rap1 signaling pathway
    102273253 (RAC1)
   04310 Wnt signaling pathway
    102273253 (RAC1)
   04370 VEGF signaling pathway
    102273253 (RAC1)
   04071 Sphingolipid signaling pathway
    102273253 (RAC1)
   04024 cAMP signaling pathway
    102273253 (RAC1)
   04151 PI3K-Akt signaling pathway
    102273253 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102273253 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102273253 (RAC1)
   04520 Adherens junction
    102273253 (RAC1)
   04530 Tight junction
    102273253 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102273253 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102273253 (RAC1)
   04620 Toll-like receptor signaling pathway
    102273253 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    102273253 (RAC1)
   04662 B cell receptor signaling pathway
    102273253 (RAC1)
   04664 Fc epsilon RI signaling pathway
    102273253 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    102273253 (RAC1)
   04670 Leukocyte transendothelial migration
    102273253 (RAC1)
   04062 Chemokine signaling pathway
    102273253 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    102273253 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102273253 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    102273253 (RAC1)
   04380 Osteoclast differentiation
    102273253 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102273253 (RAC1)
   05205 Proteoglycans in cancer
    102273253 (RAC1)
   05203 Viral carcinogenesis
    102273253 (RAC1)
   05231 Choline metabolism in cancer
    102273253 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102273253 (RAC1)
   05212 Pancreatic cancer
    102273253 (RAC1)
   05211 Renal cell carcinoma
    102273253 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102273253 (RAC1)
   05020 Prion disease
    102273253 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    102273253 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102273253 (RAC1)
   05416 Viral myocarditis
    102273253 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102273253 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102273253 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102273253 (RAC1)
   05135 Yersinia infection
    102273253 (RAC1)
   05100 Bacterial invasion of epithelial cells
    102273253 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102273253 (RAC1)
   05163 Human cytomegalovirus infection
    102273253 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102273253 (RAC1)
   05169 Epstein-Barr virus infection
    102273253 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102273253 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102273253 (RAC1)
   04031 GTP-binding proteins [BR:bom04031]
    102273253 (RAC1)
Membrane trafficking [BR:bom04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102273253 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    102273253 (RAC1)
  Macropinocytosis
   Ras GTPases
    102273253 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    102273253 (RAC1)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102273253 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   102273253 (RAC1)
  Exosomal proteins of colorectal cancer cells
   102273253 (RAC1)
  Exosomal proteins of bladder cancer cells
   102273253 (RAC1)
GTP-binding proteins [BR:bom04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102273253 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 102273253
NCBI-ProteinID: XP_014335999
LinkDB
Position
Un
AA seq 220 aa
MAAGPPLRAPRPAVGAERCRTAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPV
NLGLWDTAGQEDYDRLRPLSYPQTVGETYGKEIPSRGKEKPIADVFLICFSLVSPASFEN
VRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAV
KYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcggcaggtccacccctccgagccccgcggccggcggtcggagccgagcgttgccga
acagctgtgggtaagacttgcctcctgatcagttacactaccaatgcatttcctggagaa
tatatccccactgtctttgacaactactctgccaatgtcatggtggatggaaaacccgtg
aatctgggcttgtgggacacagccggacaagaagattatgaccgattacgccccctgtcc
tacccgcagacagttggagaaacgtatggtaaggaaataccttccaggggcaaagagaag
ccgattgccgatgtattcttaatttgcttttctctcgtgagtcctgcatcctttgaaaat
gttcgtgcaaagtggtaccctgaagtgcgacaccactgtcccaacacacccatcatcctg
gtggggacgaaacttgacctgagggacgataaagacacgatcgagaagctgaaggagaag
aagctgacgcccatcacctacccgcagggcttggccatggccaaggagatcggtgccgtc
aaatacctggagtgctcggcgctcacgcagcggggcctcaagacagtgtttgatgaggcg
atccgggctgttctctgcccaccccccgtcaagaagcggaagaggaagtgcctgctcttg
tga

KEGG   Bos mutus (wild yak): 102277352
Entry
102277352         CDS       T02919                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04071  Sphingolipid signaling pathway
bom04310  Wnt signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04510  Focal adhesion
bom04520  Adherens junction
bom04613  Neutrophil extracellular trap formation
bom04650  Natural killer cell mediated cytotoxicity
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04670  Leukocyte transendothelial migration
bom04810  Regulation of actin cytoskeleton
bom05020  Prion disease
bom05135  Yersinia infection
bom05163  Human cytomegalovirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05231  Choline metabolism in cancer
bom05416  Viral myocarditis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102277352 (RAC2)
   04014 Ras signaling pathway
    102277352 (RAC2)
   04015 Rap1 signaling pathway
    102277352 (RAC2)
   04310 Wnt signaling pathway
    102277352 (RAC2)
   04370 VEGF signaling pathway
    102277352 (RAC2)
   04071 Sphingolipid signaling pathway
    102277352 (RAC2)
   04024 cAMP signaling pathway
    102277352 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102277352 (RAC2)
   04520 Adherens junction
    102277352 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102277352 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102277352 (RAC2)
   04650 Natural killer cell mediated cytotoxicity
    102277352 (RAC2)
   04662 B cell receptor signaling pathway
    102277352 (RAC2)
   04664 Fc epsilon RI signaling pathway
    102277352 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    102277352 (RAC2)
   04670 Leukocyte transendothelial migration
    102277352 (RAC2)
   04062 Chemokine signaling pathway
    102277352 (RAC2)
  09158 Development and regeneration
   04360 Axon guidance
    102277352 (RAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102277352 (RAC2)
   05231 Choline metabolism in cancer
    102277352 (RAC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102277352 (RAC2)
   05212 Pancreatic cancer
    102277352 (RAC2)
  09164 Neurodegenerative disease
   05020 Prion disease
    102277352 (RAC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102277352 (RAC2)
   05416 Viral myocarditis
    102277352 (RAC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102277352 (RAC2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102277352 (RAC2)
   05163 Human cytomegalovirus infection
    102277352 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:bom04031]
    102277352 (RAC2)
GTP-binding proteins [BR:bom04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102277352 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 102277352
NCBI-ProteinID: XP_005887510
LinkDB
Position
Un
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRPCSIL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggagccgtgggcaagacctgcctgctc
atcagctacaccaccaacgccttccctggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagcccgtgaacctggggctgtgggacacggccggg
caggaggactatgatcgcctccggccactctcctacccgcagacggacgtcttcctcatc
tgcttctcccttgtcagcccagcctcctatgagaatgtccgggccaagtggttccccgag
gtgcggcatcactgtccgagcacaccgatcatcctggtaggcaccaagttggacctgagg
gacgacaaggacaccatcgagaagctgaaggagaagaagctggcgcctatcacctaccca
cagggcctggcactggccaaggagattgactcagtgaaatacctggagtgctcggccctc
acccagcgaggcctgaaaaccgtctttgatgaggcgatccgggccgttctgtgcccgcag
cccacacggccacagaagcgcccctgcagcatcctctag

KEGG   Bos mutus (wild yak): 102286986
Entry
102286986         CDS       T02919                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04071  Sphingolipid signaling pathway
bom04310  Wnt signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04510  Focal adhesion
bom04520  Adherens junction
bom04650  Natural killer cell mediated cytotoxicity
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04810  Regulation of actin cytoskeleton
bom05135  Yersinia infection
bom05163  Human cytomegalovirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05231  Choline metabolism in cancer
bom05416  Viral myocarditis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102286986 (RAC3)
   04014 Ras signaling pathway
    102286986 (RAC3)
   04015 Rap1 signaling pathway
    102286986 (RAC3)
   04310 Wnt signaling pathway
    102286986 (RAC3)
   04370 VEGF signaling pathway
    102286986 (RAC3)
   04071 Sphingolipid signaling pathway
    102286986 (RAC3)
   04024 cAMP signaling pathway
    102286986 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102286986 (RAC3)
   04520 Adherens junction
    102286986 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102286986 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102286986 (RAC3)
   04662 B cell receptor signaling pathway
    102286986 (RAC3)
   04664 Fc epsilon RI signaling pathway
    102286986 (RAC3)
   04062 Chemokine signaling pathway
    102286986 (RAC3)
  09158 Development and regeneration
   04360 Axon guidance
    102286986 (RAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286986 (RAC3)
   05231 Choline metabolism in cancer
    102286986 (RAC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102286986 (RAC3)
   05212 Pancreatic cancer
    102286986 (RAC3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102286986 (RAC3)
   05416 Viral myocarditis
    102286986 (RAC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102286986 (RAC3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102286986 (RAC3)
   05163 Human cytomegalovirus infection
    102286986 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:bom04031]
    102286986 (RAC3)
GTP-binding proteins [BR:bom04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102286986 (RAC3)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 102286986
NCBI-ProteinID: XP_014336816
LinkDB
Position
Un
AA seq 148 aa
MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHH
CPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRG
LKTVFDEAIRAVLCPPPVKKPGKKCTVF
NT seq 447 nt   +upstreamnt  +downstreamnt
atggtggatgggaagccggtcaacctggggctgtgggacaccgccgggcaggaggactac
gaccgcctgcggccactctcctacccccaaactgacgtcttcctgatctgcttctccctg
gtgagcccagcctcctttgagaatgttcgagccaagtggtacccagaggttcggcaccat
tgcccgcacacgcccatcctcctggtgggcaccaagctggaccttcgtgacgataaggac
accatcgagcgactgcgggataagaagctagcacccatcacgtacccccagggcctggcc
atggcccgagagatcggttctgtcaagtacctggagtgctcagccctgacccagcggggc
ctgaagacagtgttcgatgaggccattcgggctgtgctctgcccgccccctgtgaaaaag
ccagggaagaagtgcacggtcttctag

DBGET integrated database retrieval system