KEGG   Bos mutus (wild yak): 102273269
Entry
102273269         CDS       T02919                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04330  Notch signaling pathway
bom04919  Thyroid hormone signaling pathway
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102273269 (KAT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102273269 (KAT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102273269 (KAT2B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102273269 (KAT2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bom03021]
    102273269 (KAT2B)
   03036 Chromosome and associated proteins [BR:bom03036]
    102273269 (KAT2B)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102273269 (KAT2B)
Transcription machinery [BR:bom03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102273269 (KAT2B)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102273269 (KAT2B)
   HAT complexes
    PCAF complex
     102273269 (KAT2B)
    STAGA complex
     102273269 (KAT2B)
    TFTC complex
     102273269 (KAT2B)
    SAGA complex
     102273269 (KAT2B)
    SLIK complex
     102273269 (KAT2B)
    ADA-HAT complex
     102273269 (KAT2B)
    HAT-A2 complex
     102273269 (KAT2B)
    ATAC complex
     102273269 (KAT2B)
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Other DBs
NCBI-GeneID: 102273269
NCBI-ProteinID: XP_005906719
LinkDB
Position
Un
AA seq 757 aa
MPRGEWGEPAREWEEPARGLGGASEGAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTES
CRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHREEDADTKQVYFYLFKLLR
KSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPPKERQTIVELAKMFLNRI
NYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETAQVFGRTLLRSV
FTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSR
TSQLGIQTVISPPPVAGTVSYNSSSASLEQQNGGSASPSCRGASGLEANPGEKRKMNESH
VLEETKKPRVMGDIPLELIHEVMSTITDPTAMLGPETNFLSAHSARDEAARLEERRGVIE
FHVVGNSLSQKPNKKVLMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVI
GGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIG
YFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIE
RKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGRERSKEARDPDQLYSTLRSI
LQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRV
FTNCKEYNPPESEYYKCASILEKFFFSKIKEAGLIDK
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgccgcggggggaatggggggagccggcgagggagtgggaggagcccgcgcggggactg
ggaggagccagcgagggagcagaggaatcttgtaaatgcaatggctggaaaaaccccaat
ccttcgcccacgccccccagagccgacctgcagcagatcatcgtcagcctgacggagtcc
tgccggagctgcagccatgccctcgctgctcacgtgtcgcatctggagaacgtgtcggag
gaggagatgaacagactgctgggcatcgtgctggatgtggagtatctctttacctgcgtc
cacagggaagaagatgccgacaccaagcaggtttatttctacctgttcaagctcttgagg
aagtctattttacaaagaggaaaacctgtggttgaaggttctttggagaagaagccccct
tttgaaaaacctagtattgaacagggtgtgaataactttgtacagtacaaattcagtcac
ctgccacccaaagaaaggcaaacgatcgttgagctggcaaaaatgttcctgaaccgtatc
aactattggcatctggaggcaccatctcagcgaagactgcgctctcccaacgatgacatc
tctgggtacaaggagaactacaccaggtggctgtgttactgcaacgttccccagttctgc
gacagcctgccgcggtacgagacggcccaggtgttcgggaggacgctgctgcgctccgtc
ttcactgtgatgcggcggcagctgctggagcaggcgaggcaggagaaggacaaactgccg
ctggagaagcggactctgatcctcacacacttcccgaagtttctgtccatgttagaagaa
gaagtttatagtcaaaactctcctatctgggatcaggattttctctcagcttcttccaga
accagccagcttggaatccaaacagttatcagtccacctcccgtggccgggacagtttcc
tacaattcaagctccgcttcccttgaacagcagaacggagggagcgccagtccgtcctgt
cgaggcgcatccgggcttgaggcaaacccaggagaaaagaggaaaatgaacgagtctcat
gttttggaggagaccaagaagccccgggtgatgggcgatatcccactggagttaatccac
gaggtcatgtccaccatcacagaccccaccgcgatgcttgggccagagaccaactttctg
tcggcgcactcggccagggacgaggcggccaggcttgaggagcggaggggtgtaatcgag
ttccacgtggtgggcaactccctgagccagaagcccaacaagaaggtgctcatgtggctg
gtagggctgcagaacgtgttctcgcaccagctgccgcgtatgcccaaggagtacatcacc
cggctcgtcttcgacccgaaacacaaaacccttgctttaatcaaagatggccgtgtcatt
ggcggtatctgcttccggatgttcccgtcccagggcttcacagagattgttttctgcgct
gtaacctctaacgaacaagtcaagggctatggaacacacctgatgaaccacttgaaggaa
taccacataaaacacgacatcctgaacttcctcacctacgcagatgaatacgcaattgga
tatttcaagaagcagggtttctccaaagaaattaaaatccctaaaaccaaatatgttggc
tacatcaaggattatgaaggcgccactttaatgggatgtgagctaaatccacggatcccg
tacacggagttctctgtcatcattaagaagcagaaggagatcattaaaaagctgatagaa
agaaaacaagcccagattcggaaagtctacccgggactttcctgttttaaagatggagtt
cggcagatcccgatagaaagcattcctggaattcgagagacaggctggaagccgagtgga
agagagagaagtaaagaggccagagaccccgaccagctgtacagcacgctcaggagcatc
ctgcagcaggtgaagagccatcaaagcgcttggcccttcatggaacccgtgaagagaaca
gaagctccgggatattatgaagttataaggttccccatggatctgaaaaccatgagtgaa
cgcctcaagaataggtactacgtgtctaagaaactgttcatggcagatttgcagcgagtc
tttaccaattgcaaagagtacaacccccctgagagtgaatactacaaatgtgccagtatc
ctggagaaattcttcttcagtaaaattaaggaagctggattaattgacaagtga

KEGG   Bos mutus (wild yak): 102284799
Entry
102284799         CDS       T02919                                 

Gene name
KAT2A
Definition
(RefSeq) lysine acetyltransferase 2A
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04330  Notch signaling pathway
bom04919  Thyroid hormone signaling pathway
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102284799 (KAT2A)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102284799 (KAT2A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102284799 (KAT2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102284799 (KAT2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bom03021]
    102284799 (KAT2A)
   03036 Chromosome and associated proteins [BR:bom03036]
    102284799 (KAT2A)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102284799 (KAT2A)
Transcription machinery [BR:bom03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102284799 (KAT2A)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102284799 (KAT2A)
   HAT complexes
    PCAF complex
     102284799 (KAT2A)
    STAGA complex
     102284799 (KAT2A)
    TFTC complex
     102284799 (KAT2A)
    SAGA complex
     102284799 (KAT2A)
    SLIK complex
     102284799 (KAT2A)
    ADA-HAT complex
     102284799 (KAT2A)
    HAT-A2 complex
     102284799 (KAT2A)
    ATAC complex
     102284799 (KAT2A)
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Other DBs
NCBI-GeneID: 102284799
NCBI-ProteinID: XP_005899276
LinkDB
Position
Un
AA seq 837 aa
MAEPSQASTPAPAAQPRPLQSPAPTPTPTPTLSPASAPTPAPTPAPAPAPATAPAGSTGT
GGPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPATVSAAVVPSAPIFSPTMGGSSNSSLS
LDSGGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggcggaaccttcccaggcctctaccccggcccctgccgcgcagccccgtccgcttcag
tccccagcccctaccccaactccgactcctaccctcagcccagcttcggccccgactccc
gctcccactccggcaccagcccctgccccagctacagccccagccgggagcacagggact
ggggggcccggggtaggaagtgggggtaccgggagcgggggtgatccggctcgacctggc
ctgagccagcagcagcgcgccagccaaaggaaagcgcaagtccgggggctgccgcgcgcc
aagaagctagagaagctaggggtcttctcggcttgcaaggccaatgaaacctgcaagtgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggacctgcagcagccagcg
gcgaacctgagcgagctgtgccgcagctgtgagcaccctttggctgaccacgtgtcccac
ctggagaacgtgtcggaggatgagattaaccggctgctggggatggtggtggacgtggag
aatctgttcatgtctgttcacaaggaggaggacacggacaccaagcaggtctatttctac
ctcttcaagctcctgcggaaatgcatcctgcagatgacccggcctgtggtggagggatcc
ctgggcagccccccgtttgagaagcctaatattgagcagggtgtgctaaactttgtgcag
tacaagtttagtcacctggctccccgggagcggcagacaatgttcgagctctcaaagatg
ttcctgctctgccttaactactggaagcttgagacacctgcccaatttcggcagaggtct
caggccgaggatgtggctacctacaaggtcaattacaccagatggctctgctactgccac
gtgccccagagctgcgatagcctcccccggtatgagaccactcacgtctttgggcgcagc
cttctccgctccatcttcacggttacccggcgacagctgctagagaagttccgagtagag
aaggacaagctggtgcccgagaagaggaccctcatcctcacccacttccccaaattcctg
tccatgctggaggaggaaatctatggggcaaactctccaatctgggagtcgggcttcacc
atgccgccctcagagggaacacaactggtaccccggccagctacggtcagcgctgcagtt
gttcccagcgcccccatcttcagccccaccatgggtgggagcagcaacagctccttgagc
ctggattctggaggtgctgagcccatgccaggcgagaagaggaagctcccagagaacctg
accctggaggatgccaagcggcttcgtgtgatgggtgacatccccatggagctggttaac
gaggtcatgctcaccatcaccgatcctgctgccatgctagggcccgagacgagcctgctg
tcggccaacgccgcccgggacgagactgctcgcctggaagagcgccgaggcatcatcgaa
ttccatgtcatcggcaactcgctcacacccaaggccaaccggcgggtgttgctgtggctg
gtggggctacagaatgtcttctcccaccagctgccgcgaatgcccaaggagtacattgcc
cgcctcgtcttcgacccgaagcacaagactctggccttgatcaaggatgggcgggtcatt
ggtgggatttgcttccgcatgtttcccacccagggcttcacagagattgtcttctgcgct
gtaacctccaatgagcaggtcaagggctatggcactcacctgatgaaccacctgaaggag
tatcacatcaagcacaacattctctacttcctcacctacgccgacgagtacgccatcggc
tacttcaagaagcagggcttctccaaggacatcaaggtgcccaagagccgctacttgggc
tatatcaaggactacgagggtgcaacactgatggagtgtgagctgaaccctcgaatcccc
tacacggaactgtcccacatcatcaagaagcagaaggagatcatcaagaagctgattgag
cgcaaacaggcccagatccgaaaggtctaccccgggctcagctgcttcaaggagggtgtg
cgccagatccctgtggagagcgtccctggcattcgagaaacaggctggaagccactgggg
aaggaaaaagggaaggagttgaaggaccctgaccagctctacacaaccctcaaaaacctg
ctggcccagatcaagtcccaccccagtgcctggcctttcatggagcccgtgaagaagtcg
gaggccccagactactatgaggttatccgcttccccatcgacctgaagaccatgacagag
aggctgcgcagccgctactatgtgacccggaagctctttgtggccgacctgcagcgggtc
atcgccaactgccgcgagtacaaccccccggacagcgagtactgccggtgcgccagcgcc
ctggagaagttcttctacttcaagctcaaggagggcgggctcattgacaagtag

DBGET integrated database retrieval system