KEGG   Bos mutus (wild yak): 102273281Help
Entry
102273281         CDS       T02919                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00052  Galactose metabolism
bom00500  Starch and sucrose metabolism
bom01100  Metabolic pathways
bom04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102273281 (GAA)
   00500 Starch and sucrose metabolism
    102273281 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102273281 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102273281 (GAA)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102273281 (GAA)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102273281 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102273281
NCBI-ProteinID: XP_005889581
LinkDB All DBs
Position
Un
AA seq 938 aa AA seqDB search
MMRWPPCSRPLLGVCTLLSLALLGHILLHDLEVVPRELRGFSQDEIHQACQPGASSPECR
GSPRAAPTQCDLPPNSRFDCAPDKGITPQQCEARGCCYMPAEWPPDAQMGQPWCFFPPSY
PSYRLENLTTTETGYTATLTRAVPTFFPKDIMTLRLDMLMETESRLHFTIKDPANRRYEV
PLETPRVYSQAPFTLYSVEFLEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLP
SQHITGLAEHLGSLMLSTNWTKITLWNRDIAPEPNVNLYGSHPFYLVLEDGGLAHGVFKM
LNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFH
LCRWGYSTSAITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHFGDFPAMVQELH
RGGRRYIMIVDPAISSSGPAGTYRPYDEGLRRGVFITNETGQPLIGQVWPGLTAFPDFTN
PEALDWWQDMVTEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPDNSLENPPYLPGVVGGTL
QAATICASSHQFLSTHYDLHNLYGLTEALASHRALVKARGMRPFVISRSTFAGHGRYSGH
WTGDVWSNWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMR
NHNALNSQPQEPYRFSETAQQAMRKAFTLRYVLLPYLYTLFHGAHVRGETVARPLFLEFP
EDPSTWTVDRQLLWGEALLITPVLEAEKVEVTGYFPQGTWYDLQTVPMEAFGSLPPPAPL
MSVIHSKGQWVTLSAPLDTINVHLRAGHIIPMQGPALTTTESRKQPMALAVALTASGEAQ
GELFWDDGESLGVLDGGDYTQLIFLAKNNTFVNKLVHVSSEGASLQLRNVTVLGVATAPQ
QVLCNSVPVSNFTFSPDTETLAIPVSLTMGEQFVISWS
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtggccaccatgttcccgccccctgctgggggtctgcaccctcctctccttg
gcgctcctggggcacatcctgcttcatgacttggaggtggtcccccgagaactacgaggc
ttctcccaagacgagattcaccaagcttgccagccaggagccagcagcccagaatgccgt
ggcagccccagggcagcacctacacagtgcgacctgccccccaacagccgcttcgactgc
gccccagacaagggcatcaccccgcagcagtgtgaggcccgtggctgctgctacatgcct
gcagagtggcctccggatgcccagatggggcagccctggtgcttcttccctcccagctac
cccagttacaggctggagaacctgaccaccactgagacagggtacacagccaccctgacc
cgtgccgtcccgaccttcttccccaaggacatcatgaccttgaggctggacatgttgatg
gagaccgagagccgactccacttcacgatcaaagatcctgccaacagacgctatgaagtg
cccttggagaccccgcgtgtctatagccaggcgccgttcacactctacagcgtggagttc
ttggaggagccctttggggtggtcgtgcggcggaagctggacggacgggtgctgctgaac
accacggtggcccccctgttctttgcggaccagtttctgcagctgtccacctccctgcca
tcccagcacatcacaggccttgctgaacaccttgggtccctgatgctcagcaccaactgg
accaagatcaccctctggaaccgggacatcgcccctgagcccaacgtgaacctgtatgga
tctcaccctttctacctggtcctggaggatggcgggttggctcacggggtcttcaaaatg
ctgaacagcaatgccatggatgtggtcctgcagcccagcccagccctcagctggaggtcg
acaggcgggatcctggacgtgtacatcttcctgggcccggagcccaagagcgtggtgcag
cagtacctggacgtcgtgggctacccgttcatgccgccgtattggggcctgggcttccac
ctgtgccgctggggctactccacctctgccatcacccgccaggtcgtggagaacatgacc
agggcctacttccccctggacgtccagtggaatgacctcgactacatggatgccagacgg
gacttcactttcaacaaggaccacttcggggacttcccggccatggtgcaggagctccac
cggggcggtcggcggtacatcatgattgtggatcctgccatcagcagctcaggccctgct
gggacctaccgaccctacgacgagggtctgaggcggggggtcttcatcaccaatgagact
gggcagccactgattgggcaggtgtggcccggacttaccgccttccccgacttcaccaac
cccgaagctcttgactggtggcaggacatggtgaccgagttccatgcccaagtgcccttc
gatggcatgtggatcgatatgaacgagccatccaatttcgtgaggggctcagtggatggc
tgcccggacaacagcctggagaacccgccctacctgccaggggtggttggcgggaccctc
caggcagccaccatctgtgcctccagccaccagttcctgtccacgcattatgacctgcac
aacctgtatggcctgactgaagccttagcctcccacagggccctggtgaaggctcgaggg
atgcgtcccttcgtgatctctcgctcaacctttgctggccacggccgatactccggccac
tggacaggggatgtgtggagcaactgggagcagctttcctactccgtgccagaaatcctg
cttttcaatctgctgggggtgcccctggtaggggctgacatctgtggcttcctgggcaac
acctcagaggagctgtgtgtgcgttggacccagctgggggccttctaccccttcatgcgg
aaccacaatgccctgaacagccagccgcaggaaccgtacaggttcagcgagacggcgcag
caagccatgaggaaggccttcaccctgcgctacgtgctactgccctatctctacacactg
ttccacggggcccacgtcagaggcgagacagtggcccggccccttttcctggagttcccc
gaggaccccagcacctggactgtggaccgccagctcctgtggggggaggctctgctcatc
accccggtgctcgaggctgagaaggttgaagtcactggctacttcccccagggcacgtgg
tacgacctgcagacggtaccaatggaggcctttggcagcctcccacctcctgcacccctc
atgtctgtcatccacagcaaggggcagtgggtgacgctgtccgccccgctggacaccatc
aacgtccacctccgggccgggcacatcatccctatgcagggccctgccctcacgaccaca
gagtcccgcaagcagcccatggccctggctgtggccctgacagccagtggggaggcccaa
ggggagctgttctgggacgacggggagagcctgggagtgctggatggtggggactacaca
cagctcatctttctggccaagaacaacacctttgtaaacaagctggtgcacgtgagcagt
gagggggccagcctgcagctgaggaatgtgaccgtcctgggggtggccacagccccccag
caggtcctctgcaacagcgttcctgtctccaacttcaccttcagccctgacacagagact
ctggccatccctgtctcgctgaccatgggagagcagtttgtcatcagctggtcttaa

DBGET integrated database retrieval system