KEGG   Bos mutus (wild yak): 102274246
Entry
102274246         CDS       T02919                                 

Gene name
NFKB2
Definition
(RefSeq) nuclear factor kappa B subunit 2
  KO
K04469  nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04064  NF-kappa B signaling pathway
bom04380  Osteoclast differentiation
bom04625  C-type lectin receptor signaling pathway
bom05134  Legionellosis
bom05166  Human T-cell leukemia virus 1 infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102274246 (NFKB2)
   04064 NF-kappa B signaling pathway
    102274246 (NFKB2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102274246 (NFKB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102274246 (NFKB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102274246 (NFKB2)
   05203 Viral carcinogenesis
    102274246 (NFKB2)
  09162 Cancer: specific types
   05224 Breast cancer
    102274246 (NFKB2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102274246 (NFKB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102274246 (NFKB2)
   05169 Epstein-Barr virus infection
    102274246 (NFKB2)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102274246 (NFKB2)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_3 Ank Ank_5 Ank_4
Other DBs
NCBI-GeneID: 102274246
NCBI-ProteinID: XP_005888124
LinkDB
Position
Un
AA seq 903 aa
MDSCYDPGLDGIIEYDDFKFNPSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVC
AVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSRPQGLTEAERRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGSAGGYGGAGGGGGSLGFFPSSLAYSPYQSGAAPMGCYPGGGGGAQMAAETPSVDAGEE
AAEPSAPPGTPQREQQTPELLHRAREYNARLFGLAQRSARALLDYGVTADARSLLAGQRH
LLTAQDENGDTPLHLAIIHGQTTVIEQIAHVIYHAPHLGVVNITNHLHQTPLHLAVITGQ
TKVVSFLLQVGADPALLDRHGDSAVHLALRAGASAPDMLCALLRSGVPAMPQLLHVPDFE
GLYPVHLAVRARSPECLDLLVESGSGAEVEAAERQGGRTALHLATEMEELGLVTHLVTKL
RANVNARTFAGNTPLHLAAGLGSPTLTRLLLKAGADVHAENEEPLCPLPSPPTSGSDSDS
ESPERDTRGSFRGHTPLDLTRSSKVKTLLLNAAQDTMAPPLTPPSPAGPEIPLEDTVLQN
LEHLLDGPGAQGSWVELAERLGLRSLVDTYRRTASPSGSLLRSYQLAGGDWTGLLNALSD
MGLEEGVRLLKGPETQEKLPSTAEVKEDSAYGSQSVEQETEKLGPPPEPPGGLCHGRPQP
QVH
NT seq 2712 nt   +upstreamnt  +downstreamnt
atggacagttgctacgacccaggtctggatggcatcattgaatatgatgatttcaaattc
aacccgtccattgtggagcccaaggagccagccccagagacagctgatggtccctacctg
gtgatcgtggaacagcctaagcagcgaggcttccgatttcgatatggctgtgaaggccct
tcccatggaggactgccaggagcctctagcgagaagggccggaagacttatcccactgtc
aagatctgtaactacgagggacctgccaagattgaggtggacctggtaacacacagtgac
ccgcctcgtgcccatgcccacagtctggtgggcaaacagtgctcggagctgggggtctgc
gcagtgtctgtggggcccaaggacatgactgcccaatttaacaacctgggtgtcctccat
gtgaccaaaaagaacatgatggagattatgatacaaaaacttcagaggcagcgtcttcgc
tccaggccccagggccttacggaggctgagcgtcgagagctggagcaggaggccaaggaa
ctgaagaaggtgatggatctgagcattgtgcgactgcgcttttctgccttccttcgagcc
agtgatggctccttctctctgcccctgaagccagttatctcccagcccatacatgacagc
aagtctcctggagcctcaaacctgaagatttctcgaatggacaagacagctggctctgtg
cggggtggagatgaggtttatctgctctgtgacaaggtgcagaaagatgacattgaggtt
cggttctacgaggatgatgagaatggatggcaggcctttggggacttctctcccacagat
gttcacaaacagtatgccattgtgttccggacacctccctatcacaagatgaagattgag
cgtcctgtaaccgtgttcctgcaactgaaacgcaagcgtgggggggatgtctctgactcc
aaacagttcacctattatcctctggtagaagacaaggaggaggtgcagcggaagcggagg
aaagccttgcccaccttctcccagccctttgggggtggctcccacatgggtggaggctct
gggggctcggctgggggttatggaggagctggaggaggaggtggcagcctcggctttttc
ccctcctccttggcctacagcccctaccagtcgggcgcggccccaatgggctgctacccg
ggaggcgggggtggggcgcagatggccgccgagacacctagcgtggatgctggggaggaa
gcagcagagccgagcgcgccccccgggacgccccagcgcgaacagcaaaccccggagctg
ctgcatcgagcccgggagtacaacgcacgcctgttcggcctggcgcagcgcagcgctcga
gccttgctggactacggcgtcacggcggacgcacgctcgctgctggcgggacagcgccac
ctgctgactgcacaggatgagaacggagacacgccactgcacttggccatcatccacggg
cagaccaccgtcattgagcagatagcccacgtcatctaccacgccccacacctcggcgtg
gttaatatcaccaatcacttgcaccagacgcccctgcacctggcagtgatcacggggcag
acgaaggtggtgagcttcctgctgcaggtgggcgcagacccagcactgctggatcggcat
ggagactcagcagtgcacctggcactccgggcaggtgccagcgcccccgacatgctgtgc
gccctgctgcggagtggggttcctgccatgccccaactgctgcatgtacccgacttcgaa
gggctatacccagtccacctggcagtccgtgcccgaagccccgagtgcctcgatctgctg
gtggagagtgggagtggggctgaagtggaggctgcagagcggcaggggggccggacagcc
ctgcatctagccacagagatggaggagctggggttggtcacccatctcgtcaccaagctc
cgggccaacgtgaatgcccgcacctttgcgggaaacacacccctacacttggcagctgga
ctgggatccccaaccctcacccgcctccttctgaaggctggtgctgacgtccacgcagag
aacgaggagcccctgtgcccactgccttcgcctcccacctctggtagtgactcagattcc
gagagccctgagagggacacccgaggcagcttccggggccacacacctcttgacctcact
cgcagcagcaaggtgaagaccttgctgctaaatgctgctcaggacaccatggcgccgccg
ctgaccccgcccagccctgcagggccagagataccccttgaagatacagtcctacagaac
ctggagcatctgcttgatgggccaggagcccagggcagctgggtggagctggcagaacgg
ctggggttgcgcagtctggtggacacgtatcgaaggacagcctcgcccagtggcagcctc
ctgcgcagttaccagctggctggtggcgactggacgggcctgctgaatgctctgtctgac
atgggcctggaggagggggtgaggctgctgaagggtccagagacccaggaaaagctgccc
agcacagcagaggtgaaggaggacagtgcctatgggagccagtcggtggaacaggaaaca
gagaagctgggcccaccccctgagccaccaggagggctctgccacgggcgcccccagcct
caggtgcactga

KEGG   Bos mutus (wild yak): 102286396
Entry
102286396         CDS       T02919                                 

Gene name
RELB
Definition
(RefSeq) RELB proto-oncogene, NF-kB subunit
  KO
K09253  transcription factor RelB
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04064  NF-kappa B signaling pathway
bom04380  Osteoclast differentiation
bom04625  C-type lectin receptor signaling pathway
bom05166  Human T-cell leukemia virus 1 infection
bom05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102286396 (RELB)
   04064 NF-kappa B signaling pathway
    102286396 (RELB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102286396 (RELB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102286396 (RELB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286396 (RELB)
   05169 Epstein-Barr virus infection
    102286396 (RELB)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102286396 (RELB)
SSDB
Motif
Pfam: RelB_transactiv RHD_DNA_bind RelB_leu_zip RHD_dimer
Other DBs
NCBI-GeneID: 102286396
NCBI-ProteinID: XP_005900404
LinkDB
Position
Un
AA seq 564 aa
MPPCHLAALPARVCVFWSGLASGPSLPTGWAMPSRRVARSSAAPELGPLGSADLSSLSLA
VSRTTDELEIIDEYIKENGFGLEGAQPGPEGLPRLVSRGAASLSTVTLGPAVMVVGGEAF
EISALTDEVPENALSLPPSEDTVTEPAPKRGPHQNPAKLRDCGGLREVEVTACLVWKDWP
HRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPY
NAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINK
ESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIVFKTPPYEDLE
IVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELNSSDPHGI
ESKRRRKKPVFLDQFLPSHGSGPYLPPSVLLPDTDFYPGTVSLPSLEPPGGPDLXSAPAA
PTLLTMLDMLPPAPPLTSAVAGNGGAGATVGEXPGPEPLTLDSYQAPGPGDGGTASLVGS
NMFPNQYREAGFGGGLLSPGPEAT
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgccaccgtgccacctggccgctctgcccgcccgcgtgtgtgtgttttggtctgggctg
gcctccgggccgtcactccccactggttgggccatgccgagtcgccgcgtcgccagatcg
tccgctgcgccggagctcgggcccttggggtccgctgatctctcctcgctctctctcgcc
gtttccaggaccacggatgaactggagatcatcgacgagtacatcaaggagaatggcttc
ggcttggagggggcgcagcccggccccgaggggctgccacgcctggtatctcgcggggcg
gcctccctgagcaccgtcaccctgggccccgcggtgatggtggtaggaggcgaggccttt
gagatcagtgcccttacagatgaggtcccagagaacgccctcagccttcccccatctgag
gacacggtgacagagcctgcgcccaaaagaggccctcaccagaacccagccaagctccgg
gactgtggagggctgcgggaggtggaggtgactgcctgcctggtgtggaaggactggcct
caccgagttcatccccacagcctcgtggggaaagactgcacggacggcgtctgcagggtg
cggctccggcctcatgtcagccctcggcacagctttaacaacctgggcatccagtgtgtg
aggaagaaggagatcgaggctgccatcgagcggaagattcagctgggcattgacccctac
aacgctgggtccctgaagaaccatcaggaggtggacatgaatgttgtgaggatttgcttc
caggcctcatacagggatcagcaaggacagatgcgccggatggaccctgtgctctctgag
cccgtctacgacaagaagtctacaaacacgtcggagctacgaatttgccgaatcaacaag
gagagtgggccgtgcacgggtggcgaggaactctacctactgtgcgacaaggtgcagaaa
gaggatatatcggtggtgttcagcagagcctcctgggaaggccgggctgacttctcccag
gccgatgtgcaccgccagatcgccattgtgttcaagacaccaccctacgaggacctggag
atcgttgaacctgtgacagtgaacgtctttctgcagcggcttactgatggggtctgcagt
gagcctctgcccttcacctacctgcctcgggaccatgacagctatggtgtggacaagaag
cggaaacgggggctgcctgacgtccttggggagttgaatagctctgatccccatggcatt
gagagcaaacgacggaggaaaaaaccagtcttcctggatcaattcctgcccagccatggc
tcaggaccgtacctcccgccgtcagtgctgctacccgacacagacttctacccgggcacc
gtatccctccccagcctggaaccccccggcgggccggacctcncctccgcccccgctgcc
cccacgctcttgaccatgctggacatgttgcccccagcgccaccactcaccagcgctgtc
gcgggcaacggcggtgcaggggctacggtcggggagnccccgggcccggagccgctcacg
ctggactcgtaccaggccccgggccccggggacggaggcactgccagcctcgtgggcagc
aacatgttccccaaccagtaccgtgaggccggctttgggggtggcctcctgtccccgggc
cctgaggccacgtag

DBGET integrated database retrieval system