KEGG   Bos mutus (wild yak): 102274304
Entry
102274304         CDS       T02919                                 

Gene name
MYC
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04110  Cell cycle
bom04151  PI3K-Akt signaling pathway
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04350  TGF-beta signaling pathway
bom04390  Hippo signaling pathway
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04630  JAK-STAT signaling pathway
bom04919  Thyroid hormone signaling pathway
bom05132  Salmonella infection
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05213  Endometrial cancer
bom05216  Thyroid cancer
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102274304 (MYC)
   04012 ErbB signaling pathway
    102274304 (MYC)
   04310 Wnt signaling pathway
    102274304 (MYC)
   04350 TGF-beta signaling pathway
    102274304 (MYC)
   04390 Hippo signaling pathway
    102274304 (MYC)
   04630 JAK-STAT signaling pathway
    102274304 (MYC)
   04151 PI3K-Akt signaling pathway
    102274304 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102274304 (MYC)
   04218 Cellular senescence
    102274304 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102274304 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102274304 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102274304 (MYC)
   05202 Transcriptional misregulation in cancer
    102274304 (MYC)
   05206 MicroRNAs in cancer
    102274304 (MYC)
   05205 Proteoglycans in cancer
    102274304 (MYC)
   05230 Central carbon metabolism in cancer
    102274304 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102274304 (MYC)
   05225 Hepatocellular carcinoma
    102274304 (MYC)
   05226 Gastric cancer
    102274304 (MYC)
   05216 Thyroid cancer
    102274304 (MYC)
   05221 Acute myeloid leukemia
    102274304 (MYC)
   05220 Chronic myeloid leukemia
    102274304 (MYC)
   05219 Bladder cancer
    102274304 (MYC)
   05213 Endometrial cancer
    102274304 (MYC)
   05224 Breast cancer
    102274304 (MYC)
   05222 Small cell lung cancer
    102274304 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102274304 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102274304 (MYC)
   05161 Hepatitis B
    102274304 (MYC)
   05160 Hepatitis C
    102274304 (MYC)
   05163 Human cytomegalovirus infection
    102274304 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102274304 (MYC)
   05169 Epstein-Barr virus infection
    102274304 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102274304 (MYC)
   03019 Messenger RNA biogenesis [BR:bom03019]
    102274304 (MYC)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    102274304 (MYC)
Messenger RNA biogenesis [BR:bom03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102274304 (MYC)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 102274304
NCBI-ProteinID: XP_014334976
LinkDB
Position
Un
AA seq 437 aa
MPLNVSFANKNYDLDYDSVQPYFYCDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSSADQLEMVTELLGGDMVNQSFICDPD
DETLIKNIIIQDCMWSGFSAAAKLVSGKLXQAPPKAGAAPSPARGHGGCSTSSLYLQDLS
AAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEPLALHE
ETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGSHSKPPHSPLVLKRCHV
STHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHNVL
ERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEQQKLKSEIDVLQK
RREQLKLKLEQIRNSCA
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaagaactatgacctcgactacgattcggtgcag
ccttatttctactgcgacgaggaggagaacttctaccaccagcagcagcagagcgaactg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccgtcgtacgtcgcggtcgcctccttc
tcgcccaggggagacgacgacggcggcggcggcagcttctcctcagcggaccagttggag
atggtgaccgagctgctaggaggcgacatggtgaaccagagcttcatctgcgaccccgac
gatgagaccctcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcggggaagctgngccaggcgccgccgaaagccggcgccgccccg
agccccgcccgcgggcacggcggctgctccacctccagcttgtacctgcaggacctgagc
gccgccgcctccgaatgcatcgacccctcggtggtcttcccctacccgctcaacgacagc
agctcgcccaagccctgcgcctccccggactccaccgccttttctccgtcctctgactct
ctgctctcctctgctgagtcctccccgcgggccagtcccgagcccctggcgctccatgag
gagaccccacccacgaccagtagcgactctgaggaagaacaagaggatgaggaagaaatt
gatgttgtttctgtggaaaagaggcagccccctgccaaaaggtcagaatcggggtcaccc
tctgccggcagccacagcaaacctcctcacagcccgttagtcctaaagagatgccacgtg
tctacccatcagcacaattacgcagcgcccccctccactaggaaggactatcccgccgcc
aagagggctaagttggacagtggcagggtcctgaaacagatcagcaacaaccgcaaatgt
gccagcccgaggtcttcggacacggaggagaatgacaagaggcggacacacaacgttttg
gagcgccagaggagaaacgagctgaaacgcagcttttttgctcttcgtgaccagatccca
gagttggagaacaatgaaaaagcccccaaggtagttatccttaaaaaagccacagcgtac
atcctgtcggtccaagcagagcagcaaaagctcaagtcagaaatagacgtgttgcagaag
aggcgagaacagttgaaactcaaacttgaacagatacggaactcttgcgcctaa

DBGET integrated database retrieval system