KEGG   Bos mutus (wild yak): 102274306Help
Entry
102274306         CDS       T02919                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    102274306 (MAPK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102274306 (MAPK6)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102274306 (MAPK6)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102274306 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 102274306
NCBI-ProteinID: XP_005900518
UniProt: L8I9U9
LinkDB All DBs
Position
Un
AA seq 722 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELSSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIEEVQLDPRALSDVTDEEDVQVDPRKYLDGDREKYLEDPAFDTSYS
TEPCWQYPDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAEKEREKNQGFDFDSFIAGTIQLSSQ
HEAADVVDKLNDLNSSVSQLELKSLISKSVSREKQEKGMANLAQLEALYQSSWDSQFVGG
GEDCFLINQFCCEVRKDEQIEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGNEE
GFLNSSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKH
LN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggctctaggtat
atggacttaaaaccattgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgcgaaatcaaaattattagaagacttgaccacgataacattgtgaaggtg
tttgaaattcttggtcctagtggaagccagttaacggatgacgtgggctctcttaccgaa
ctgagcagtgtttacattgttcaggaatacatggagacagacttggctaatgtgctggag
cagggccctttactggaagagcacgccaggcttttcatgtatcagctgctgcgtgggctc
aaatacattcactcagcaaacgtgctgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcacggatcatggatccc
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattcctgttgtccatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtcgagaagcactggatttcctggaacaaattttgacattcagc
cccatggatcggttgacagcagaagaagcgctttcccatccttacatgagcatttattct
tttccaatggatgagccaatctcaagtcatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcatagtcacatttataactgggaaaggtaccatgattgt
caattttcagagcatgattggcctatacataacaactttgatattgaggaagttcaacta
gacccaagagctctgtctgatgtcactgatgaagaagatgtacaagttgatcctcgaaaa
tatttggatggagatcgtgaaaagtatttggaggatcctgcttttgacaccagttactct
actgagccttgttggcagtacccagatcatcatgaaaacaaatactgtgatctggagtgt
agccatacttgtaactacaaaacgaggtcatcatcatatttagataacttagtttggaga
gagagtgaagttaatcattattatgaacccaagcttattatagatctttctaattggaaa
gaacaaagcaaagaaaaatctgataagaagggcaagtcaaaatgtgaaaggaatggattg
gttaaagcccagatagctttagaggaagcatcacagcaactggctgaaaaagaaagggaa
aagaatcagggatttgactttgattcctttattgcaggaactattcaacttagttcacaa
catgaggctgctgatgttgttgacaaattaaatgacttgaatagctcagtgtcccaatta
gaattgaaaagtttgatatcaaagtcagtaagccgagaaaaacaggaaaaaggaatggca
aatttggctcaattagaagcattgtatcaatcttcttgggatagccagtttgtgggtggt
ggggaggactgttttctcataaatcaattttgttgtgaggtaaggaaagatgagcaaatt
gaaaaggaaaacacttataccagttacctggacaagttttttagcaggaaagaagatact
gaaatgctagaaactgagccggtagaggatgggaagcttggggagagaggaaatgaggaa
ggatttctgaacagcagtggggaattcctcttcaacaagcagcttgaatccataggcatc
ccacagtttcacagtccagttgggtcaccacttaagtcaatacaggccacattaacacct
tctgctatgaaatcttcccctcagattcctcataagacatacagcagcattctgaaacat
ctgaactaa

DBGET integrated database retrieval system