KEGG   Bos mutus (wild yak): 102274398
Entry
102274398         CDS       T02919                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein
  KO
K05640  glial fibrillary acidic protein
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102274398 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102274398 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bom04812]
    102274398 (GFAP)
Membrane trafficking [BR:bom04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    102274398 (GFAP)
Cytoskeleton proteins [BR:bom04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     102274398 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head Spc7 DUF1664 DUF4407 T6PP_N
Other DBs
NCBI-GeneID: 102274398
NCBI-ProteinID: XP_005903405
UniProt: L8I2X9
LinkDB
Position
Un
AA seq 430 aa
MERRRVTSATRRSYVSSSEMVVGGRRLGLGPGPRLSLARMPPPLPARVDFSLAGALNSGF
KETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRE
LRLRLDQLTANSARLEVERDNLAQDLGTLRQKLQDETNQRLEAENNLAAYRQEADEATLA
RLDLERKIESLEEEIRFLRKIHEEEVRELQEQLAQQQVHVEMDVAKPDLTAALREIRTQY
EAVASSNMHEAEEWYRSKFADLNDAAARNAELLRQAKHEANDYRRQLQALTCDLESLRGT
NESLERQMREQEERHAREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIE
IATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIK
ESKQEHKDVM
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggagaggagacgggtcacctcagccactcgccgctcctatgtctcctcctcagagatg
gtggtggggggccgccgcctgggcctgggtcccggcccccgcctgtccttggctcgaatg
ccgcctccactcccagcccgggtggacttctccctggccggggcactcaactccggcttc
aaggagacccgggccagcgagagggcagagatgatggagctcaatgaccgcttcgccagc
tacattgagaaggtgcgcttcctggagcagcagaacaaggcgctggctgccgagctcaac
cagctgcgggccaaggaacccaccaagctggccgacgtctaccaggcggagctgcgcgag
ctgcgcctgcggctcgatcaactcactgccaacagcgcccggctcgaggtggagagggac
aacctggcacaggacctgggcaccttgaggcagaagctccaggatgaaaccaaccagagg
ctggaggctgagaacaacctggctgcctatcgacaggaagcagatgaagccaccctggcc
cgtctggatctggagaggaagattgagtctctggaggaggaaatccggttcttgaggaag
atccatgaggaggaggtgcgggagctccaggagcagctggcccagcagcaggtccacgtg
gagatggatgtagccaagcctgacctcacagcggccctgagagagatccgcacacagtat
gaggcagtggcatccagcaacatgcatgaggcggaggagtggtaccggtccaagtttgcg
gacctgaacgacgccgccgcccgcaacgcggagctgctccgccaggccaagcatgaggcc
aacgactaccggcggcagctgcaggccttgacctgcgacctggagtccttgcgcggcacg
aacgagtccctggagcggcagatgcgcgagcaagaggagcgccacgcgcgggaggcggcg
agttaccaggaggcgctggcccggctggaggaagaggggcagagcctcaaggacgagatg
gcgcgccacctgcaggaataccaggatctgctcaacgtcaaactggccctggacatcgag
atcgccacctacaggaagctgctagagggcgaggagaaccgcatcaccattcctgtgcag
accttctccaacctgcagatccgagaaaccagcctggacaccaagtccgtgtcagaaggc
cacctcaagaggaacattgtggtgaagaccgtggagatgcgggatggagaggtcattaag
gagtccaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system