KEGG   Bos mutus (wild yak): 102274647
Entry
102274647         CDS       T02919                                 

Gene name
MAPKAPK2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04218  Cellular senescence
bom04370  VEGF signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04722  Neurotrophin signaling pathway
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102274647 (MAPKAPK2)
   04370 VEGF signaling pathway
    102274647 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102274647 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102274647 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102274647 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102274647 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102274647 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102274647 (MAPKAPK2)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102274647 (MAPKAPK2)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   102274647 (MAPKAPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like Choline_kinase
Other DBs
NCBI-GeneID: 102274647
NCBI-ProteinID: XP_014332450
LinkDB
Position
Un
AA seq 395 aa
MGIFLVCPREINTIRHCRSEHGILPKVKMFTKLTAEKERVPVLGSSLQIKKNAIIDDYKV
TTQVLGLGINGKVLQIFSKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYE
NLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHR
DVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCD
MWSLGVIMYILLCGYPPFYSNHGLAISPGMKSRIRMGQYEFPNPEWSEVSEEVKMLIRNL
LKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRV
DYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgggcatcttccttgtgtgccccagggagatcaacaccatccgccactgcaggtctgag
catggcatcttgcccaaagtcaagatgttcactaaattaactgccgagaaagaacgagta
ccggtgttagggtcgagcctgcagatcaagaagaacgccatcatcgacgactacaaggtc
accacgcaggtcctggggctgggcatcaacggcaaagttctgcagatcttcagcaagagg
acacaggagaaattcgccctaaaaatgctgcaggactgccccaaggcccgccgcgaggtg
gagctgcactggcgtgcctcgcagtgcccgcacatcgtgcgcatcgtggacgtgtacgag
aacctgtacgcggggcggaagtgcctgctgatcgtcatggagtgtttggatggcggagaa
ctgttcagtcgaatccaggaccgaggagaccaggccttcacggaaagagaggcctcagag
atcatgaagagcattggcgaggccatccagtatttgcactcaatcaacatcgcccatcgg
gatgtcaagcccgagaaccttttatacacctccaaaaggcccaatgccattctcaaactc
actgattttggctttgccaaggaaaccaccagtcacaactctctgaccactccttgttac
acgccatactacgtggctccagaggtgctgggcccagagaagtacgacaagtcctgtgac
atgtggtccttgggtgtcatcatgtacatcctgctgtgtgggtacccccccttctattcc
aaccatggccttgccatctctccgggcatgaagagtcgcatccgaatgggccagtatgaa
ttccccaacccagaatggtcagaagtatcagaggaagtgaagatgctcatccggaacctg
ctgaagaccgagcccacccagaggatgaccatcactgagttcatgaaccacccctggatc
atgcaatcgacgaaggtccctcaaaccccactgcacaccagccgggtcctgaaggaggac
aaggagaggtgggaggacgtcaaggaggagatgaccagtgccttggccacaatgcgggtc
gactacgagcagatcaagataaaaaagattgaagacgcgtccaaccctctgcttctgaag
aggcggaagaaagcccgggccctggaggccgcggcccttgctcactga

DBGET integrated database retrieval system