KEGG   Bos mutus (wild yak): 102274978Help
Entry
102274978         CDS       T02919                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00020  Citrate cycle (TCA cycle)
bom00190  Oxidative phosphorylation
bom01100  Metabolic pathways
bom01200  Carbon metabolism
bom04714  Thermogenesis
bom04932  Non-alcoholic fatty liver disease (NAFLD)
bom05010  Alzheimer disease
bom05012  Parkinson disease
bom05016  Huntington disease
Module
bom_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bom_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bom_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102274978 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102274978 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102274978 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102274978 (SDHB)
   05012 Parkinson disease
    102274978 (SDHB)
   05016 Huntington disease
    102274978 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102274978 (SDHB)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102274978 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 102274978
NCBI-ProteinID: XP_014337013
LinkDB All DBs
Position
Un
AA seq 288 aa AA seqDB search
MWVPATVPDSGDITVNKKDVVPDPWHEKLRCQACRGAQTAAAAAPRIKKFAIYRWDPDKT
GDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLA
CTRRIDTNLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQGGKEQYLQ
SIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLA
KLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKQASA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtaccagccactgtgccggactctggggacatcacagtgaacaagaaagacgtg
gttcctgacccctggcatgagaagctgagatgtcaggcctgccgtggggctcagacagct
gcagccgcagcaccccgaatcaagaaatttgccatctatcgatgggacccggacaagact
ggagacaaacctcacatgcaaacttatgagattgatttgaataactgtggtcctatggtg
ctggatgctctaatcaagattaagaatgaaattgattccaccctgaccttccggagatca
tgcagagaaggcatctgcggctcctgtgccatgaacatcaacggaggcaacactctggcg
tgcacccgcaggatcgacaccaacctcagcaaagtttccaaaatctaccctctgccacac
atgtatgtgataaaggaccttgttcctgatttgagcaacttctatgctcagtacaagtcc
atcgagccttacttaaagaagaaggatgagtcccagggaggcaaggagcagtatctgcag
tccatagaagaccgtgagaaactggacgggctctatgagtgtatcctctgcgcctgctgc
agcaccagctgcccgagctactggtggaacggagacaagtacctgggccccgccgtgctc
atgcaggcctatcgctggatgatcgactccagagacgacttcacggaggagcgcctggcc
aagctgcaggaccccttctctctctaccgctgccacaccatcatgaactgcacgcagacc
tgccccaaggggctgaatcctgggaaagctattgctgaaatcaagaagatgatggcaacc
tataaagagaagcaggcttctgcttaa

DBGET integrated database retrieval system