KEGG   Bos mutus (wild yak): 102275053
Entry
102275053         CDS       T02919                                 

Gene name
FOS
Definition
(RefSeq) Fos proto-oncogene, AP-1 transcription factor subunit
  KO
K04379  proto-oncogene protein c-fos
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04024  cAMP signaling pathway
bom04210  Apoptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04668  TNF signaling pathway
bom04713  Circadian entrainment
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04921  Oxytocin signaling pathway
bom04926  Relaxin signaling pathway
bom04928  Parathyroid hormone synthesis, secretion and action
bom04932  Non-alcoholic fatty liver disease
bom04935  Growth hormone synthesis, secretion and action
bom05031  Amphetamine addiction
bom05132  Salmonella infection
bom05133  Pertussis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05161  Hepatitis B
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05210  Colorectal cancer
bom05224  Breast cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05323  Rheumatoid arthritis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102275053 (FOS)
   04668 TNF signaling pathway
    102275053 (FOS)
   04024 cAMP signaling pathway
    102275053 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102275053 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102275053 (FOS)
   04660 T cell receptor signaling pathway
    102275053 (FOS)
   04658 Th1 and Th2 cell differentiation
    102275053 (FOS)
   04659 Th17 cell differentiation
    102275053 (FOS)
   04657 IL-17 signaling pathway
    102275053 (FOS)
   04662 B cell receptor signaling pathway
    102275053 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102275053 (FOS)
   04917 Prolactin signaling pathway
    102275053 (FOS)
   04921 Oxytocin signaling pathway
    102275053 (FOS)
   04926 Relaxin signaling pathway
    102275053 (FOS)
   04935 Growth hormone synthesis, secretion and action
    102275053 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    102275053 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    102275053 (FOS)
   04728 Dopaminergic synapse
    102275053 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102275053 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102275053 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275053 (FOS)
   05231 Choline metabolism in cancer
    102275053 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102275053 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102275053 (FOS)
   05224 Breast cancer
    102275053 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102275053 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    102275053 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102275053 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102275053 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102275053 (FOS)
   05135 Yersinia infection
    102275053 (FOS)
   05133 Pertussis
    102275053 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102275053 (FOS)
   05170 Human immunodeficiency virus 1 infection
    102275053 (FOS)
   05161 Hepatitis B
    102275053 (FOS)
   05171 Coronavirus disease - COVID-19
    102275053 (FOS)
   05162 Measles
    102275053 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275053 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102275053 (FOS)
   05142 Chagas disease
    102275053 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102275053 (FOS)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    102275053 (FOS)
Membrane trafficking [BR:bom04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102275053 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 102275053
NCBI-ProteinID: XP_005901051
LinkDB
Position
Un
AA seq 384 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT
LPLLNDPEPKPSVEPVKXXXXXVGSMELKAEPFDDYMFPASSRPSGSETARSVPDMDLSG
SFYAADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAA
AHRKGSSSNEPSSDSLSSPTLLAL
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgccgactacgaggcatcctcctcccgctgcagcagcgcc
tccccggccggggacagtctctcctactaccactcaccggccgactccttctccagcatg
ggttctcccgtcaatgcgcaggactactgcaccgatctggccgtctccagtgccaacttc
atcccaacagtgactgccatctcgaccagcccggacctacaatggctagtacagcccacc
ctagtctcctccgtggccccgtcccagaccagagccccccacccctatggagtccctact
ccctcagctggggcttactccagggctggagtcatgaaaaccatgacaggaggcagagct
cagagcattggccggaggggcaaggtagaacagttgtccccagaagaagaagagaaaagg
cgaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag
ctgactgacaccctccaagcggagacagaccaactagaagatgagaagtcggctttgcag
acagagattgccaatctgctgaaggagaaggaaaaactcgagttcatcctagcggctcac
cgacctgcctgcaagatccccgatgacctgggcttcccagaagagatgtctgtggcttct
cttgatctgagtgggggcctgcctgaggctgccacccctgaatctgaggaggccttcacc
ctgccactcctcaatgaccctgagcccaagccctcagtggagcccgtcaagnnnnnnnnn
nnnngcgtcggcagcatggagctgaaggctgagccctttgatgactacatgttcccagca
tcatccaggcccagcggctcggagaccgcccgctctgtgccagacatggacctgtctggt
tccttctatgcagcagactgggagcccctgcatggtggctccctggggatggggcctatg
gccacggagctggagcccctgtgcaccccggtggtcacctgtactcccagctgcactact
tacacgtcttccttcgtcttcacctaccctgaggctgactccttccccagctgtgcggct
gcccaccgcaagggcagcagcagcaacgagccttcctctgactcgctcagctcacccacg
ctgctggccctgtga

DBGET integrated database retrieval system