KEGG   Bos mutus (wild yak): 102275218
Entry
102275218         CDS       T02919                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha and beta receptor subunit 2
  KO
K05131  interferon receptor 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05160  Hepatitis C
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275218 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    102275218 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275218 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102275218 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102275218 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    102275218 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    102275218 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102275218 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275218 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102275218 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    102275218 (IFNAR2)
   05164 Influenza A
    102275218 (IFNAR2)
   05162 Measles
    102275218 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    102275218 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275218 (IFNAR2)
   05169 Epstein-Barr virus infection
    102275218 (IFNAR2)
   05165 Human papillomavirus infection
    102275218 (IFNAR2)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IFN receptor family
   102275218 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind Pox_A6 Uroplakin_II
Other DBs
NCBI-GeneID: 102275218
NCBI-ProteinID: XP_005893407
UniProt: L8IPU6
LinkDB
Position
Un
AA seq 530 aa
MLLSQNVSAIGPLNLYPMVHISLVFGISYVAPVLSDEHCTLKMRFRNFQSVLSWELKNHS
IVPTHYTLWYTIMSKREDMKVVKDCINVTRSFCDLTDVWVNTTDMYIPQVVGFRENAKLV
ICMGSFFLAPDKPLDPPEFEIVGFTNHISVNVKFQFDSPGILSEELQFYLAFIEEHAGNS
VKRHQPQITGNITKNFNYVIDKLIPNTNYCISVYFEPKDPRKINRSPLKCTLFRPRRESE
SSESATIGGIITLFLITAVFISTVMILKRIGYICLRNDFPKVLNFYKLSVWVFPELPPLE
KVATVEVIHVNRKKKVWNYNYDDENDIENEAAPHLNSGGYTKHGLTGKLCPTSTTSASLE
DCSLEDCSEPSAKEPYLPEPKGDAETPMAPGPGPWQSEGTSGGYQTRGTLWQDPTSEEDS
DSTEGSEGRIVFNVNLNSVCVRALEDDKDSEVTLMSPSCPEETVELEDLNETESSVLVAS
EEGTQLPFTNPSTECPRPQDAPSDKSDTSESDVDMGDGYIVRQVNLKKFN
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgcttttgagccagaatgtgtcagcgattggaccactgaatttgtatcccatggtgcac
atcagcctcgtgtttggtatttcgtatgttgcgcctgttctttcagatgaacattgcact
ttaaagatgagattccgaaatttccagtcagtcttatcatgggaattaaaaaaccattca
attgtaccaactcactatacattatggtacacaatcatgagtaaacgagaagatatgaag
gtcgtcaaggactgtataaacgtcacaagatcgttttgtgacctcacagacgtgtgggta
aacacgacggacatgtacatcccccaggtggttggattcagagagaacgcaaagctggtc
atttgtatgggctctttcttcctggcgccagacaagcctttggacccaccagagtttgag
attgttggttttacaaaccacatcagtgtgaatgtgaaatttcaattcgacagtcccggg
atactaagtgaagaattacagttttacttagcatttattgaagagcatgcagggaacagt
gttaagaggcatcaaccccaaataactggaaacatcaccaaaaatttcaattatgtcatc
gacaagttaattccaaacacaaactactgtatatccgtttattttgagcctaaagatcca
agaaaaataaacagatctcccttaaaatgtaccctctttcgacccagacgagaatcagag
tcatcagaatctgctacaataggaggaataattactctgtttttaataactgctgtcttc
ataagcactgtaatgatactgaaacggattggctatatatgcttaagaaatgatttcccc
aaagttttgaatttttataaactgtcagtctgggtgtttcccgagctgcccccgttggaa
aaagtggctaccgtggaagtcattcacgtcaacaggaagaagaaagtgtggaattataat
tatgacgatgaaaatgacatcgaaaatgaggcagctccccacttaaattcaggtggttac
accaagcacggactaacgggcaagctgtgtccaacttccaccacttcagccagcttggag
gactgcagcttggaggactgtagtgagcccagtgctaaggagccgtatctgcctgagccc
aagggggacgccgagacccccatggcaccagggcccggcccctggcagtcggaaggcaca
agtgggggctaccagacgagagggactctgtggcaggaccccacttccgaggaggacagt
gactccacggaggggtctgagggcagaatcgtcttcaacgtgaatttgaactctgtgtgt
gtgagagcccttgaggatgacaaggactcagaagtcactctaatgtccccatcttgtcca
gaagagacagtcgagctggaggacctcaacgagacagaatcaagcgttttggtggccagt
gaagaagggacacagctgcccttcaccaacccctctacggagtgcccgaggccccaagat
gctccttctgataaaagtgacacttccgagtcagatgttgacatgggggatgggtatata
gtaagacaagtgaatctaaaaaaatttaattaa

KEGG   Bos mutus (wild yak): 102275793
Entry
102275793         CDS       T02919                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275793 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    102275793 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275793 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102275793 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102275793 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    102275793 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    102275793 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102275793 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275793 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102275793 (IFNAR1)
   05160 Hepatitis C
    102275793 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    102275793 (IFNAR1)
   05164 Influenza A
    102275793 (IFNAR1)
   05162 Measles
    102275793 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    102275793 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275793 (IFNAR1)
   05169 Epstein-Barr virus infection
    102275793 (IFNAR1)
   05165 Human papillomavirus infection
    102275793 (IFNAR1)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IFN receptor family
   102275793 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 CHASE5
Other DBs
NCBI-GeneID: 102275793
NCBI-ProteinID: XP_005893409
LinkDB
Position
Un
AA seq 560 aa
MLALLGATTLMLVAGRWVLPAASGEANLKPENVEIHIIDDNFFLKWNSSSESVKNVTFSA
DYQILGTDNWKKLSGCQHITSTKCNFSSVELENVFEKIELRIRAEEGNNTSTWYEVEPFV
PFLEAQIGPPDVHLEAEDKAIILSISPPGTKDSIMWAMDRSSFRYSVVIWKNSSSLEERT
ETVYPEDKIYKLSPEITYCLKVKAELRLQSRVGCYSPVYCINTTERHKVPSPENIQINAD
NQIYVLKWDYPYENATFQAQWLRAFFKKIPGNHSDKWKQIPNCENVTSTHCVFPREVSSR
GIYYVRVRASNGNGTSFWSEEKEFNIEMKTIIFPPVISVKSVTDDSLHVSVGASEESENM
SVNQLYPLIYEVIFWENTSNAERKVLEKRTNFIFPDLKPLTVYCVKARALIENDRRNKGS
SFSDTVCEKTKPGNTSKTWLIVGTCTALFSIPVVIYVVSVFLRCVKYVFFPSSKPPSSVD
EYFSDQPLRNLLLSTSEEQTERCFIIENASVITEIEETDEIDEVHKKYSSQTSQDSGNYS
NEDENSGSKISEEFPQQDSV
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgctcgctctcctgggcgcgacgaccctgatgctggtcgctgggagatgggtgctgccc
gccgcctcaggggaagcaaatctgaagcctgaaaatgtcgagatccacatcattgatgac
aattttttcctgaagtggaacagcagcagtgagtctgtcaagaatgtgactttttcagca
gattatcaaatactaggaacggataactggaagaaattgtctgggtgtcaacatattact
agtaccaaatgcaacttttcttcagtcgagcttgaaaatgtttttgaaaaaattgaattg
cgcataagagcagaagaaggaaacaacacttccacatggtatgaggttgagccatttgta
ccatttctagaagctcagattggtcccccagatgtgcatttagaagctgaagataaggca
ataatactgagtatctctccccctggaacaaaagatagtatcatgtgggctatggatcgt
tcaagctttaggtatagtgtcgttatctggaaaaactcttcaagtctagaagaaagaacg
gaaactgtttatcccgaagataaaatttataaactgtcaccagagattacttattgttta
aaagttaaagcagaactgcgtttacaaagtagagttggttgctatagtccagtgtattgt
ataaataccacagagagacataaagtaccttcaccagaaaatatacaaatcaatgctgac
aaccagatctatgttcttaagtgggattacccatatgaaaacgcaacttttcaagctcag
tggctccgtgccttttttaaaaagattcctgggaatcattcagacaaatggaaacaaata
ccgaactgtgaaaatgtcacaagtacccactgtgtctttcctcgagaggtttcctcaagg
ggaatttactatgtccgtgtacgagcatctaatggaaatggtacctctttttggtctgaa
gagaaggaatttaatattgaaatgaaaactatcatatttcctccagtcatcagcgtgaaa
tccgttactgatgattcactgcatgtcagtgttggtgcttcagaagagtctgaaaacatg
tctgtgaatcagctctacccgctaatttatgaagtaattttttgggaaaacacttcaaat
gctgagagaaaagttctagagaaaagaaccaattttatctttcctgacttgaaaccgctg
actgtgtattgtgtcaaagccagagcactcattgaaaatgacaggcggaataaagggagc
agttttagtgatactgtgtgtgagaaaacaaaaccaggaaatacttccaaaacctggctt
atagttggaacttgcactgcattgttttctattcctgtggtcatttatgttgtgagcgtc
ttcttgagatgtgtcaagtatgtgttcttcccatcaagtaaacctccttcctctgttgac
gagtatttctccgatcagccactaaggaatctactcctttccacttctgaggaacaaacg
gaaagatgttttataattgaaaatgcaagcgttattactgaaatagaagagactgatgaa
attgatgaagttcacaaaaagtacagttcccaaactagtcaagattcaggaaactattca
aacgaagatgaaaacagtggaagcaaaataagcgaagagtttccgcaacaggacagtgtg
tga

DBGET integrated database retrieval system