Bos mutus (wild yak): 102275352 Help Entry 102275352         CDS       T02919                                  Symbol NPY Name (RefSeq) neuropeptide Y   KO K05232   neuropeptide Y Organism bom  Bos mutus (wild yak) Pathway bom04024   cAMP signaling pathway bom04080   Neuroactive ligand-receptor interaction bom04920   Adipocytokine signaling pathway bom04923   Regulation of lipolysis in adipocytes bom05034   Alcoholism Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102275352 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102275352 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     102275352 (NPY)    04920 Adipocytokine signaling pathway     102275352 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     102275352 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bom04052]     102275352 (NPY) Cytokines and neuropeptides [BR:bom04052]  Neuropeptides   Neuropeptides (GPCR binding)    102275352 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  102275352 NCBI-ProteinID:  XP_005902935 UniProt:  L8I7G8 LinkDB All DBs Position Un AA seq 97 aa AA seqDB search MLGSKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDLARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTGNIPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctgggtagcaagcgactgggcttgtccggactgaccctcgccctgtccctgctcgtg tgcctgggcgccctggccgaggcgtacccctccaagcctgacaaccccggcgaggacgct ccggcggaggacttggccagatactactcagcgctgcgacactacatcaatctcatcacc aggcagagatacgggaaacgatctagccccgagaccctgatttcagacctcttgatgaga gaaagcacgggaaacattcccagaactaggctggaagacccttctatgtggtga

DBGET integrated database retrieval system