KEGG   Bos mutus (wild yak): 102275402
Entry
102275402         CDS       T02919                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04064  NF-kappa B signaling pathway
bom04210  Apoptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04668  TNF signaling pathway
bom04722  Neurotrophin signaling pathway
bom04920  Adipocytokine signaling pathway
bom04926  Relaxin signaling pathway
bom04931  Insulin resistance
bom05132  Salmonella infection
bom05134  Legionellosis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05215  Prostate cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102275402 (NFKBIA)
   04668 TNF signaling pathway
    102275402 (NFKBIA)
   04024 cAMP signaling pathway
    102275402 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102275402 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102275402 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    102275402 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    102275402 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    102275402 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    102275402 (NFKBIA)
   04660 T cell receptor signaling pathway
    102275402 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    102275402 (NFKBIA)
   04659 Th17 cell differentiation
    102275402 (NFKBIA)
   04657 IL-17 signaling pathway
    102275402 (NFKBIA)
   04662 B cell receptor signaling pathway
    102275402 (NFKBIA)
   04062 Chemokine signaling pathway
    102275402 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102275402 (NFKBIA)
   04926 Relaxin signaling pathway
    102275402 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102275402 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102275402 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275402 (NFKBIA)
   05203 Viral carcinogenesis
    102275402 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102275402 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102275402 (NFKBIA)
   05215 Prostate cancer
    102275402 (NFKBIA)
   05222 Small cell lung cancer
    102275402 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102275402 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102275402 (NFKBIA)
   05135 Yersinia infection
    102275402 (NFKBIA)
   05134 Legionellosis
    102275402 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102275402 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    102275402 (NFKBIA)
   05161 Hepatitis B
    102275402 (NFKBIA)
   05160 Hepatitis C
    102275402 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    102275402 (NFKBIA)
   05164 Influenza A
    102275402 (NFKBIA)
   05162 Measles
    102275402 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    102275402 (NFKBIA)
   05163 Human cytomegalovirus infection
    102275402 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275402 (NFKBIA)
   05169 Epstein-Barr virus infection
    102275402 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102275402 (NFKBIA)
   05140 Leishmaniasis
    102275402 (NFKBIA)
   05142 Chagas disease
    102275402 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102275402 (NFKBIA)
   04131 Membrane trafficking [BR:bom04131]
    102275402 (NFKBIA)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    102275402 (NFKBIA)
Membrane trafficking [BR:bom04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102275402 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 102275402
NCBI-ProteinID: XP_014332495
LinkDB
Position
Un
AA seq 303 aa
MFQPAEPGQDWAMEGPRDLIITSRKTPRPRPPETPALRNPPRGAPPRAPRSALTSPGGFP
SLPLRFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALL
EAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATNYNGHTCLHLAS
IHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGY
SPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDELPYDDCVLGGQR
LTL
NT seq 912 nt   +upstreamnt  +downstreamnt
atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacctcata
ataacctcgcggaaaacaccgcggcctcggcctccagaaaccccggccttgcgcaatccc
ccgcggggcgcgcctccccgggccccacgcagtgcactcaccagccctgggggttttccc
tctcttcctctcaggttcctgcacttagccatcatccatgaagagaaggcgctgaccatg
gaagtggtccgccaagtgaagggagacctggccttcctcaacttccagaacaacctgcag
cagacgccactccacttggctgtgatcactaaccagccagaaatcgctgaggcacttctg
gaagctggctgtgatcctgagcttcgagactttcgaggaaatacccccctacaccttgcc
tgtgagcagggctgcctggccagtgtgggagtcctgactcagccccgggggacccagcac
ctccactccatcctgcaggccaccaactacaatggccacacgtgtctgcacttggcctct
attcatggctacctgggcatcgtggagctgttggtgtccttgggcgctgatgtcaacgct
caggagccctgcaatggccgaactgccctccatctggcagtggacctgcagaatcccgac
ctggtgtcactcctattgaagtgtggggctgatgtcaacagagtcacctaccagggctac
tccccgtaccagctcacgtggggccgccccagcacccggatacagcagcagctgggccag
ctgaccctagagaaccttcagacactgccggagagcgaggatgaggagagctatgacacc
gaatcagagttcacagaggacgagcttccctacgatgactgtgtgcttggaggccagcgt
ctgacgttatga

DBGET integrated database retrieval system