KEGG   Bos mutus (wild yak): 102275474
Entry
102275474         CDS       T02919                                 

Gene name
CSF2
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04650  Natural killer cell mediated cytotoxicity
bom04657  IL-17 signaling pathway
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04668  TNF signaling pathway
bom05146  Amoebiasis
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05171  Coronavirus disease - COVID-19
bom05202  Transcriptional misregulation in cancer
bom05221  Acute myeloid leukemia
bom05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275474 (CSF2)
   04668 TNF signaling pathway
    102275474 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275474 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102275474 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    102275474 (CSF2)
   04660 T cell receptor signaling pathway
    102275474 (CSF2)
   04657 IL-17 signaling pathway
    102275474 (CSF2)
   04664 Fc epsilon RI signaling pathway
    102275474 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102275474 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102275474 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102275474 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102275474 (CSF2)
   05171 Coronavirus disease - COVID-19
    102275474 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275474 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102275474 (CSF2)
Messenger RNA biogenesis [BR:bom03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     102275474 (CSF2)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102275474 (CSF2)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102275474 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 102275474
NCBI-ProteinID: XP_005888437
UniProt: L8IZE0
LinkDB
Position
Un
AA seq 143 aa
MWLQNLLLLGTVVCSFSAPTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVS
EKFDSQEPTCLQTRLKLYKKGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFK
NFKEDLKEFLFIIPFDCWEPAQK
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttctcctgggcactgtggtctgcagcttctccgcacctact
cgcccacccaacactgccacccggccctggcagcatgtggatgccatcaaggaggccctg
agccttctgaaccacagcagtgacactgatgctgtgatgaatgacacagaagtcgtctct
gaaaagtttgactcccaggagccaacgtgcctgcagactcgcctgaagctgtacaagaag
ggcctgcagggcagcctcactagtctcatgggctccttgaccatgatggccacccactac
gagaaacactgcccacccaccccggaaacttcctgtggaacccagtttatcagcttcaaa
aatttcaaagaggacctgaaggagttcctttttatcattccctttgactgctgggaacca
gcccagaagtga

DBGET integrated database retrieval system