Bos mutus (wild yak): 102275474 Help Entry 102275474         CDS       T02919                                  Gene name CSF2 Definition (RefSeq) colony stimulating factor 2   KO K05427   granulocyte-macrophage colony-stimulating factor Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04630   JAK-STAT signaling pathway bom04640   Hematopoietic cell lineage bom04650   Natural killer cell mediated cytotoxicity bom04657   IL-17 signaling pathway bom04660   T cell receptor signaling pathway bom04664   Fc epsilon RI signaling pathway bom04668   TNF signaling pathway bom05146   Amoebiasis bom05166   Human T-cell leukemia virus 1 infection bom05167   Kaposi sarcoma-associated herpesvirus infection bom05171   Coronavirus disease - COVID-19 bom05202   Transcriptional misregulation in cancer bom05221   Acute myeloid leukemia bom05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102275474 (CSF2)    04668 TNF signaling pathway     102275474 (CSF2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102275474 (CSF2)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102275474 (CSF2)    04650 Natural killer cell mediated cytotoxicity     102275474 (CSF2)    04660 T cell receptor signaling pathway     102275474 (CSF2)    04657 IL-17 signaling pathway     102275474 (CSF2)    04664 Fc epsilon RI signaling pathway     102275474 (CSF2)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102275474 (CSF2)   09162 Cancer: specific types    05221 Acute myeloid leukemia     102275474 (CSF2)   09163 Immune disease    05323 Rheumatoid arthritis     102275474 (CSF2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102275474 (CSF2)    05171 Coronavirus disease - COVID-19     102275474 (CSF2)    05167 Kaposi sarcoma-associated herpesvirus infection     102275474 (CSF2)   09174 Infectious disease: parasitic    05146 Amoebiasis     102275474 (CSF2) Messenger RNA biogenesis [BR:bom03019]  Eukaryotic type   mRNA degradation factors    3'-5' decay     Other 3'-5' decay factors      102275474 (CSF2) Cytokines and growth factors [BR:bom04052]  Cytokines   CSF and other factors    102275474 (CSF2) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Cytokines    102275474 (CSF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GM_CSF Motif Other DBs NCBI-GeneID:  102275474 NCBI-ProteinID:  XP_005888437 UniProt:  L8IZE0 LinkDB All DBs Position Un AA seq 143 aa AA seqDB search MWLQNLLLLGTVVCSFSAPTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVS EKFDSQEPTCLQTRLKLYKKGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFK NFKEDLKEFLFIIPFDCWEPAQK NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtggctgcagaacctgcttctcctgggcactgtggtctgcagcttctccgcacctact cgcccacccaacactgccacccggccctggcagcatgtggatgccatcaaggaggccctg agccttctgaaccacagcagtgacactgatgctgtgatgaatgacacagaagtcgtctct gaaaagtttgactcccaggagccaacgtgcctgcagactcgcctgaagctgtacaagaag ggcctgcagggcagcctcactagtctcatgggctccttgaccatgatggccacccactac gagaaacactgcccacccaccccggaaacttcctgtggaacccagtttatcagcttcaaa aatttcaaagaggacctgaaggagttcctttttatcattccctttgactgctgggaacca gcccagaagtga

DBGET integrated database retrieval system