KEGG   Bos mutus (wild yak): 102275510
Entry
102275510         CDS       T02919                                 

Gene name
FOSL1
Definition
(RefSeq) FOS like 1, AP-1 transcription factor subunit
  KO
K04502  fos-like antigen 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04310  Wnt signaling pathway
bom04380  Osteoclast differentiation
bom04657  IL-17 signaling pathway
bom05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102275510 (FOSL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    102275510 (FOSL1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102275510 (FOSL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102275510 (FOSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102275510 (FOSL1)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    102275510 (FOSL1)
SSDB
Motif
Pfam: bZIP_1 bZIP_Maf bZIP_2 DUF3450 Macoilin TMCO5 DUF4407 UPF0242
Other DBs
NCBI-GeneID: 102275510
NCBI-ProteinID: XP_005894093
LinkDB
Position
Un
AA seq 268 aa
MFRDYGEPGPSSGAGGAXTQPPATGQQKFHLVPSINTVSGNQELQWMVQPHFLGPSSYPR
PLAYPPYSPPQPRPGVIRALGPTPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRR
KELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKESETSGT
GGASGTSSPPGPSRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEP
CASAHRKSSSSSGDPSSDPLGSPTLLAL
NT seq 807 nt   +upstreamnt  +downstreamnt
atgttccgagactacggggaacccggaccgagctccggcgccggcggcgcgntgactcag
cccccggccacaggccagcagaagttccacctcgtgccaagcatcaacactgtgagtggc
aaccaggagcttcagtggatggttcaacctcacttcctgggacccagcagctaccccagg
cctctggcctatcccccgtacagtcccccgcagccccggccaggagtcatacgggccctg
ggcccaactccaggggtgcgtcgccggccctgtgaacagatcagccccgaggaggaggaa
cgccgtcgagtgaggcgggagaggaacaagctagccgcggccaagtgcaggaaccggagg
aaagaattgaccgacttcctgcaggcggagaccgacaaactggaggatgagaaatctgga
ctgcagcgagagattgaggagctgcagaaacagaaggagcgcctggagctggtgctcgaa
gcccaccgccccatctgcaaaatcccagaaggggccaaggagagcgaaaccagcggcaca
ggtggtgccagcggcaccagcagcccgccaggcccctcccgccctgtgccatgtatctcc
ctttccccagggcctgtacttgaacccgaagcattgcacactcccacgctcatgaccaca
ccctccctgactcctttcacccctagtctggtcttcacataccccagtacgccagagccc
tgtgcctcagcccatcgcaagagtagcagcagcagtggggacccctcttctgatcccctg
ggctccccaaccctcctggccttatga

DBGET integrated database retrieval system