KEGG   Bos mutus (wild yak): 102275760
Entry
102275760         CDS       T02919                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04664  Fc epsilon RI signaling pathway
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05221  Acute myeloid leukemia
bom05310  Asthma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275760 (IL3)
   04151 PI3K-Akt signaling pathway
    102275760 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275760 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102275760 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102275760 (IL3)
   04664 Fc epsilon RI signaling pathway
    102275760 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275760 (IL3)
   05202 Transcriptional misregulation in cancer
    102275760 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102275760 (IL3)
  09163 Immune disease
   05310 Asthma
    102275760 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102275760 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102275760 (IL3)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102275760 (IL3)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Haparin
  Cytokines
   102275760 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 102275760
NCBI-ProteinID: XP_005888438
UniProt: L8J314
LinkDB
Position
Un
AA seq 144 aa
MSSLSILHLLLLLLALHAPQAKGLPVVTSRTPYSMLMKEIMDDLKKITPSPEGSLNSDEK
NFLTKESLLQANLKVFMTFATDTFGNDSKIMKNLKEFQPVLPTATPTEDPIFIENKNLGD
FRMKLEEYLVIIRNYLKSKNIWFS
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcagtctctccatcttgcacctgcttctgctcctgcttgcactccatgcccctcag
gcaaaggggttgcctgtcgtgacatcgaggactccatattctatgttgatgaaggaaatt
atggatgacctaaagaaaataactccgagtccagaaggctccttgaactcagatgagaag
aatttcctgacgaaagagagccttctgcaggcaaacctgaaagtattcatgacatttgcc
acagatacttttggaaacgattcaaaaatcatgaaaaatcttaaggaattccagcctgtg
ctgcccacagccacacccacggaagatccaatttttattgagaacaagaacttgggcgat
ttccggatgaaattggaagaatatttggttatcattagaaactatctgaagtccaagaac
atatggttttcctaa

DBGET integrated database retrieval system