KEGG   Bos mutus (wild yak): 102275975
Entry
102275975         CDS       T02919                                 

Gene name
BAD
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04140  Autophagy - animal
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04370  VEGF signaling pathway
bom04510  Focal adhesion
bom04722  Neurotrophin signaling pathway
bom04910  Insulin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05165  Human papillomavirus infection
bom05168  Herpes simplex virus 1 infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102275975 (BAD)
   04014 Ras signaling pathway
    102275975 (BAD)
   04370 VEGF signaling pathway
    102275975 (BAD)
   04024 cAMP signaling pathway
    102275975 (BAD)
   04022 cGMP-PKG signaling pathway
    102275975 (BAD)
   04151 PI3K-Akt signaling pathway
    102275975 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102275975 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    102275975 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102275975 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102275975 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102275975 (BAD)
   04919 Thyroid hormone signaling pathway
    102275975 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102275975 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275975 (BAD)
   05203 Viral carcinogenesis
    102275975 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102275975 (BAD)
   05212 Pancreatic cancer
    102275975 (BAD)
   05225 Hepatocellular carcinoma
    102275975 (BAD)
   05221 Acute myeloid leukemia
    102275975 (BAD)
   05220 Chronic myeloid leukemia
    102275975 (BAD)
   05218 Melanoma
    102275975 (BAD)
   05211 Renal cell carcinoma
    102275975 (BAD)
   05215 Prostate cancer
    102275975 (BAD)
   05213 Endometrial cancer
    102275975 (BAD)
   05223 Non-small cell lung cancer
    102275975 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102275975 (BAD)
   05014 Amyotrophic lateral sclerosis
    102275975 (BAD)
   05020 Prion disease
    102275975 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    102275975 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102275975 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102275975 (BAD)
   05161 Hepatitis B
    102275975 (BAD)
   05160 Hepatitis C
    102275975 (BAD)
   05162 Measles
    102275975 (BAD)
   05168 Herpes simplex virus 1 infection
    102275975 (BAD)
   05165 Human papillomavirus infection
    102275975 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102275975 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102275975 (BAD)
   01524 Platinum drug resistance
    102275975 (BAD)
   01522 Endocrine resistance
    102275975 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 102275975
NCBI-ProteinID: XP_005894183
LinkDB
Position
Un
AA seq 168 aa
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSH
HGGTGAVETRSRHSSYPAGPEDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggacaggcccccaggtctcagcaagcactggctaaca
gccccaggcctcctgggggaagctggtcaccagcaggggcagccggccggcagcagccac
catggaggcactggggctgtggagacccggagtcgtcacagctcctaccccgcggggcca
gaggataatgaagagacggaggaggaggatctcggcccctttaggggccgctcgcgttcg
gcgccccccaacctctgggctgcacagcgatatggccgcgagctccggaggatgagcgac
gagtttcacgtctccttcaaggggcttcctcgcccgaagagcgcgggcacggcaacgcaa
atgcgacaaagccccagctggacgcgcttcctccagtcctggttgagccggaacttgggg
agaggaggctccgccccctcccagtga

DBGET integrated database retrieval system