KEGG   Bos mutus (wild yak): 102275978
Entry
102275978         CDS       T02919                                 

Gene name
IRF7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
bom  Bos mutus (wild yak)
Pathway
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05164  Influenza A
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102275978 (IRF7)
   04621 NOD-like receptor signaling pathway
    102275978 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    102275978 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    102275978 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102275978 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102275978 (IRF7)
   05160 Hepatitis C
    102275978 (IRF7)
   05164 Influenza A
    102275978 (IRF7)
   05162 Measles
    102275978 (IRF7)
   05168 Herpes simplex virus 1 infection
    102275978 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275978 (IRF7)
   05169 Epstein-Barr virus infection
    102275978 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102275978 (IRF7)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    102275978 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 102275978
NCBI-ProteinID: XP_005895176
LinkDB
Position
Un
AA seq 481 aa
MAEAPDRGTPRVLFGDWLLGEVSSGRYEGLRWLDAARTRFRVPWKHFARKDLGEADSRIF
KAWAVARGRWALPRGGGAPPPIPESALRASWKTNFRCALRSTQRFVMLEDNSGDPTDPHK
VYKISSEPGCPEGLGFDQGEDEALEDAPPARGGLLGPCLAADTGESLGHRLNPEPCPPSL
AGDAGDLLIQALQQSCLEDHLLDLTPPEAPDAGPPPEPWQPLEAEPHMGASASACTPMAG
EPPLAGPGYSQLGLQPEPSLGALDLSILYKGRTVLQEVVGRPRCVLLYGPSAVAGGAPAL
QQVAFPSPAGLPDQKQLHYTEKLLQHVAPGLQLELRGPWLWARRLGKCKVYWEVGGPLGS
ASTSSPARLLPRDCDTPIFDFGTFFQELVEFRAQQRRGSPHYTIYLGFGQDLSVGRPKEK
SLVLVKLEPWLCRAYLEAVQREGVSSLDSGSLSLCLSSSNSLYEDLEHFLEHFMMEVEQA
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggccgaggctccagaccggggaaccccgcgcgtgctcttcggagactggcttctgggc
gaggtcagcagcggccgctatgaggggctacggtggctggacgcggcccgaacgcgcttc
cgcgtaccctggaagcatttcgcgcggaaggacctgggcgaggccgattcgcgcatcttt
aaggcctgggccgtggcccgcggcaggtgggcgctcccccgcggggggggggcccccccg
ccgatccctgagagtgcgctgcgggcctcctggaaaaccaacttccgctgcgctctgcgc
agcacgcaacgctttgtgatgttggaagacaactcgggggaccctaccgaccctcataag
gtgtacaagatcagctccgagccggggtgcccagaaggcctaggctttgaccagggggag
gacgaggccctagaagatgccccacctgcaaggggtggcctcctggggccctgcctggca
gcagatactggtgagagcctggggcaccggctgaaccctgaaccctgccccccaagccta
gctggagatgccggggacctcttgatccaggcgctgcagcagagctgcttggaggaccat
ctgctggatctgacccccccagaggctcctgatgcaggcccacccccagagccctggcag
cccctagaggcagagccccacatgggagcctctgccagtgcctgcacgccaatggcaggg
gagccgcccctggctggccctggctactcacagcttggtttgcagccggagcccagccta
ggggccctggacttgagcatcctgtataaaggccgaaccgtgctgcaggaggtggtgggg
cgtccacgctgcgtgctgctgtacggcccttctgctgtagctggaggggctccagcgctg
cagcaggtagccttccccagccctgccgggctgcccgaccagaagcagctccactacacg
gagaagctgctgcagcatgtggctcctggcctgcagctggagctccgggggccgtggctg
tgggcccggcgcctgggcaagtgcaaagtctactgggaggtgggggggcccctgggctca
gccagcacctccagccccgctcgcctgctgccccgggactgtgacacgcccatctttgac
ttcggcaccttcttccaagaactggtggagttccgggcccagcagcgccgcggctccccg
cactacaccatctacttgggcttcgggcaggacctatcagtggggaggcccaaggagaag
agcctggtcctggtgaagctggagccgtggctgtgccgggcgtacctggaggctgtgcaa
cgcgaaggtgtgtcctccctggacagtggcagcctcagcctctgcctctccagctctaac
agcctctacgaagacctggagcacttcctggagcacttcatgatggaggtggaacaggct
gcctaa

DBGET integrated database retrieval system