KEGG   Bos mutus (wild yak): 102276047Help
Entry
102276047         CDS       T02919                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00250  Alanine, aspartate and glutamate metabolism
bom00410  beta-Alanine metabolism
bom00430  Taurine and hypotaurine metabolism
bom00650  Butanoate metabolism
bom01100  Metabolic pathways
bom04727  GABAergic synapse
bom04940  Type I diabetes mellitus
Module
bom_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102276047 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102276047 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102276047 (GAD2)
   00430 Taurine and hypotaurine metabolism
    102276047 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    102276047 (GAD2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    102276047 (GAD2)
Enzymes [BR:bom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102276047 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102276047
NCBI-ProteinID: XP_005908868
UniProt: L8HSI2
LinkDB All DBs
Position
Un
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESSG
SQPPRATSRKAACSCNQKPCSCPKAEVNYAFLHATDLLPACDGERPTLEFLQEVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTIGFEAHIDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRVLDNNEERLSRLSKVAPVIKARMMES
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcccggctctggcttttggtcctttggatctgaagatggctcgggggatccc
gagaaccccggcacagccagggcctggtgtcaggtggcccagaagttcacgggcggcatc
ggaaacaaactgtgcgctctgctctatggagacgccgagaagccggcggagagcagcggg
agccagcccccgcgggccacctcccgcaaggccgcctgctcctgcaaccagaagccctgc
agctgccccaaagcggaggtcaactatgcatttctacacgcaacagatctgctaccagcg
tgtgacggagaaaggcccactttggagtttctgcaagaggttatggacattttgcttcag
tatgtggtgaagagttttgatagatcaaccaaagtgattgattttcattaccctaatgag
cttcttcaagaatataattgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatacgcaattaaaacaggacatccaaggtatttcaat
caactttctactggactggatatggttggattagcagcagactggctgacatcaacagca
aacactaacatgttcacctatgaaattgctccagtatttgtgcttttggaatatgtcacg
ctaaagaaaatgagagaaatcattggctggcctgggggctctggcgatgggatattttct
cctggtggcgctatatccaacatgtacgccatgctgattgcgcgctttaaaatgttcccg
gaagtcaaggagaaaggaatggctgcggtccccaggctcattgccttcacgtctgagcat
agccatttttctctcaagaagggagctgcagccttgggcattggaacagacagtgtgatt
ctgattaaatgtgatgaaagggggaaaatgatcccgtctgaccttgaaagaaggatcctt
gaagccaaacaaaaagggtttgtccctttccttgtgagcgccacggctgggaccactgtg
tatggagcatttgaccccctgttagcggttgctgacatttgcaaaaagtataagatctgg
atgcacgtggatgcagcttggggtgggggattactgatgtctcggaaacacaagtggaaa
ctgagcggcgtggagagggccaactctgtgacctggaatccacataagatgatgggcgtt
cctttgcagtgctctgctctcctggttagagaagagggattgatgcagagctgcaaccag
atgcatgcctcctacctcttccaacaagataaacactacgacctgtcctacgacactgga
gacaaggccttgcagtgcggacgccacgtcgatgtttttaagctctggctaatgtggagg
gcaaaggggaccatcgggtttgaagcacatattgataagtgtttggagctggcggagtat
ttatacaatatcatcaaaaaccgagaaggttatgaaatggtgtttgatggaaagcctcag
cacaccaatgtctgcttctggtacgtacctccgagcttgcgtgtcctggacaacaatgaa
gagagactgagccgcctctccaaggtggctcccgtgattaaagccaggatgatggagtct
gggaccacaatggtgagctaccagcccttgggcgacaaggtcaacttcttccgcatggtc
atctcaaaccccgcagcaactcaccaagacattgacttcctgattgaagaaatagaacgc
ctgggacaggatttataa

DBGET integrated database retrieval system