KEGG   Bos mutus (wild yak): 102276164
Entry
102276164         CDS       T02919                                 

Gene name
RALBP1
Definition
(RefSeq) ralA binding protein 1
  KO
K08773  RalA-binding protein 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04014  Ras signaling pathway
bom05200  Pathways in cancer
bom05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102276164 (RALBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102276164 (RALBP1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102276164 (RALBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102276164 (RALBP1)
Membrane trafficking [BR:bom04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    102276164 (RALBP1)
SSDB
Motif
Pfam: RhoGAP Nod1
Other DBs
NCBI-GeneID: 102276164
NCBI-ProteinID: XP_005911305
UniProt: L8HLU3
LinkDB
Position
Un
AA seq 635 aa
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDSLHEPPDV
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
LDVPSLRPIFGIPLADAVERTMMYDGVRLPAVFRECVDYVEKHGMKCEGIYRVSGIKSKV
DELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTKELLPRFEEACGRSSEAEKV
QEFQRLLEDLPECSRLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVTLKQVTKPLRWSNMATMPTLPETQESIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
DSESESEDEDELQLILQDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQLQRAR
PEPLAEPEPGAREPPPPTKEQARPSPGRERKETPI
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgaccgagtgcttcctgccccccaccagcagccccagtgagcaccgcagggtggagcat
ggcagcgggctcacccgcacccccagctctgaggagatcagccccaccaagtttcccggg
ctgtaccgcacgggcgagccctcacccccccacgacagcctccacgagcctcccgacgta
gtgtctgacgatgagaaggaccatgggaagaagaaaggaaagttcaagaaaaaggaaaaa
aggactgagggctatgctgcctttcaggaagatagttcgggggatgaagccgaaagtcct
tcgaaaatgaagaggtccaaggggatccatgtcttcaagaagcccagcttttctaaaaag
aaagagaaggattttaaaataaaagagaaacccaaagaggaaaaacataaggaagaaaag
cacaaagaggagaagcataaagagaagaagtcaaaagacttgacagcagctgacgtggtt
aaacagtggaaggagaagaagaagaagaagaagccgattcaggagccagaggtgcctcag
ctggacgtcccgagcctcaggcccatcttcgggatcccgctggctgacgcggtggagagg
accatgatgtacgacggcgtgcggctgcccgcagtcttccgggagtgtgtggactacgtg
gagaagcacggcatgaagtgcgagggcatctacagggtgtcaggaattaaatccaaggtg
gatgagctgaaagcagcctacgacagagaggaatctccaaacttggaagagtatgaaccg
aacacggtggccagtttgctgaagcagtacctgcgggacctgcctgagaacctgctgacc
aaggagctcctgcctcgcttcgaggaggcgtgtggccggagctcggaggccgagaaggtg
caggagttccagcgcctgttggaagacctgccggagtgcagccgccttctcatctcctgg
ctcatcgtgcacatggaccatgttattgccaaggaactggaaacgaaaatgaacatccag
aacatttccatagtgctcagccccactgtgcagattagcaatcgtgttctgtatgtattt
ttcacacatgtgcaagagctctttggaaatgtgacactgaagcaagtgacgaagcccctg
cgatggtctaacatggccacgatgcccacactgcctgagacccaggagagtatcaaggag
gagatacggagacaggagtttcttttgaattgtttacatcgagatctacagggcgggata
aaggatttatcgaaagaggagagattatgggaagtacaaagaattctgacagccctcaag
agaaaactgagagaagctaaaagacaagaatgtgaaaccaagattgcccaagaaatagcc
agtctttcaaaagaggatgtttccaaagaagaaatgaatgaaaacgaggaagtcataaat
attcttcttgcccaggagaatgagatcctgactgagcaggaggagctcctagccatggag
cagttcctgcgccgacagattgcctcggagaaggaagagatcgagcgcctccgggcggag
atcgccgagatccagagccgccagcagcacggccgcagcgagaccgaggagtactcatca
gacagtgagagcgagagcgaggacgaggacgagctgcagctcatcctgcaagacctgcag
cggcagaacgaggagctggagatcaagaacaaccacctgaaccaggccattcacgaggaa
cgcgaggccatcattgagctgcgggtgcagcttcgcttgctccaactgcagcgcgcgcgc
cccgaacccctggctgagcccgagcccggagcccgggagccgcccccgcccaccaaggag
caggcgcggccgtcgccaggcagggagcggaaggagacgcccatctga

DBGET integrated database retrieval system