KEGG   Bos mutus (wild yak): 102276245
Entry
102276245         CDS       T02919                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04012  ErbB signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04151  PI3K-Akt signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04934  Cushing syndrome
bom05162  Measles
bom05165  Human papillomavirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05203  Viral carcinogenesis
bom05206  MicroRNAs in cancer
bom05215  Prostate cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102276245 (CDKN1B)
   04066 HIF-1 signaling pathway
    102276245 (CDKN1B)
   04068 FoxO signaling pathway
    102276245 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    102276245 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102276245 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102276245 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    102276245 (CDKN1B)
   05206 MicroRNAs in cancer
    102276245 (CDKN1B)
   05203 Viral carcinogenesis
    102276245 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    102276245 (CDKN1B)
   05220 Chronic myeloid leukemia
    102276245 (CDKN1B)
   05215 Prostate cancer
    102276245 (CDKN1B)
   05222 Small cell lung cancer
    102276245 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102276245 (CDKN1B)
   04934 Cushing syndrome
    102276245 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    102276245 (CDKN1B)
   05169 Epstein-Barr virus infection
    102276245 (CDKN1B)
   05165 Human papillomavirus infection
    102276245 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102276245 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102276245
NCBI-ProteinID: XP_005890092
UniProt: L8IWW9
LinkDB
Position
Un
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFKNHKPLEGKYEWQEVEKGSLPEFYHRPPRPPKGACKVPAQEGQDASGARPAVPLLG
SQANPEDTHLVDQKTDAPDSQTGLAEQCPGIRKRPAADDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagtccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctcggcttgcagaaacctctttggcccggtcaatcacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggccagccagcgcaagtgg
aattttgattttaagaatcacaagcccctggagggcaagtacgagtggcaggaggtagaa
aagggcagcctgcccgagttctaccacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggaaggccaggatgccagcggggcccgcccggcggtccctttacttggg
tctcaggcaaacccagaggacacgcatttggtcgatcagaagactgatgccccggacagc
cagaccgggttagcggagcagtgccctgggataaggaagcgacctgccgcagatgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttcccccaac
gccggttcagtggagcagacgcccaagaagcctggcctcagaaggcgtcagacgtaa

DBGET integrated database retrieval system