KEGG   Bos mutus (wild yak): 102276249Help
Entry
102276249         CDS       T02919                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00512  Mucin type O-glycan biosynthesis
bom01100  Metabolic pathways
Module
bom_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102276249 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bom01003]
    102276249 (GALNT9)
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102276249 (GALNT9)
Glycosyltransferases [BR:bom01003]
 O-Glycan biosynthesis
  Mucin-type
   102276249 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 102276249
NCBI-ProteinID: XP_005891269
UniProt: L8ITE4
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRLQDRSEGLVQIVRSADRRVRSRHAKVGALAE
REAILQRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGMAATLRDDSQETEGKFEEYGY
NAQLSDRISLDRSIPDYRPKKCRQMTYSDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SQLLKEVILVDDNSDNVELKLNLDQYVSKRYPGLVKIVRNSRREGLIRARLQGWKVATAP
VVGFFDAHVEFSTGWAEPALTRIREDRRRIVLPAIDNIKYDTFEVQQYASAAHGYNWGLW
CMYIVPPQDWLDRGDEAAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDGFKSHVYMAWNIP
MTNPGVDFGDVSERLALRQRLKCRSFKWYLDNVYPEMRTYNDTLTYGEVRNSKASGYCLD
QGAEDDDRAILYPCHGMSSQLVRYSAEGLLQLGPLGSTAFLPDSKCLVDDGRGRTPALKK
CEDVARPAQRLWDFTQGGPIVSRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWTIRNWIK
PGRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccaggaagatcaaaactttgctgacggtcaacatcctggtgttcgtgggc
atcatcctcttctccgtgtactgccgcctgcaggaccgctcagaggggctggtgcagatc
gttcgcagtgccgaccgccgggtgcgcagccggcatgccaaggtgggcgcgctggctgag
cgcgaagccatcctgcagcgccttgaccacctggaggaggtagtctacaaccagctgaat
ggtcttgccaagcccattggtctggtggaggggccaggaggcctgggccagggcggcatg
gcggccacgctgcgggatgacagccaggagacggaaggcaagttcgaggaatacgggtac
aatgcacagctcagcgaccgcatctccctggaccgtagcatcccggactacaggcccaaa
aagtgcagacagatgacctactcggatgacctgccccagatctctgtggtgttcatcttt
gtcaatgaagccctctcagtcatcctgcgctccgtccacagcgtggtcaaccacacgccc
tcccagctcctcaaggaggtgatcctggtggacgacaacagtgataatgtggaactcaag
ctcaacctggaccaatacgtcagcaagagatacccgggcctggtgaagatcgtccgcaac
agcaggcgggaaggcctgatccgggcgcggttacagggttggaaggtcgccacggccccc
gtcgttggcttctttgatgcccatgtggagttcagcacaggctgggccgagcccgccctt
acgcggatccgggaggaccgccggcggatcgtcctgccagccatcgacaacatcaagtac
gacacgttcgaggtgcagcaatacgccagcgcagcccacggctacaactggggcctttgg
tgcatgtacatcgtcccgccccaggactggctggaccgtggcgacgaggcggcgcccatc
aggaccccggccatgatcggctgctccttcgttgtggaccgggagtacttcggggacatt
ggtctgctggacccaggcatggaggtgtacggtggggagaacatagagctgggcatgagg
gtgtggcagtgtggtggcagcatggaggtgctcccctgctcccgcgtggcccacatcgag
cgcaccaagaagccctacaacaatgacatcgactactacgccaagcgcaatgccctgcga
gcggccgaggtgtggatggacggcttcaagtcccacgtgtacatggcctggaacatcccc
atgaccaacccaggcgtggacttcggggacgtgtccgagcggctggccctgcgccagagg
ctgaagtgccgcagcttcaagtggtacctggacaacgtgtacccggagatgaggacgtac
aacgacaccctcacgtacggagaggtgagaaacagcaaagccagcggctactgcttagac
caaggagcggaggacgatgaccgtgccatcctgtacccctgccacgggatgtcctcccag
ctggtgcggtacagcgccgagggcctgctgcagctgggccccctgggctccaccgccttc
ctgcctgactccaagtgcctggtggatgacggcaggggccgcacgcccgccctgaagaag
tgcgaggatgtggcccggcccgcgcagcggctgtgggacttcacccagggtggccccatt
gtgagcagagacacaggccggtgcctggaggtggagatgtccaaggatgccaactttggg
ctccgcctggtggtgcagaggtgctcaggacagaaatggaccatcagaaactggatcaag
ccagggcggcactga

DBGET integrated database retrieval system